KEGG   Azospirillum sp. B510: AZL_a01720Help
Entry
AZL_a01720        CDS       T01169                                 

Definition
(GenBank) hypothetical protein
Organism
azl  Azospirillum sp. B510
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP NigD_C Synapsin
Motif
Other DBs
NCBI-ProteinID: BAI73703
RhizoBase: AZLa01720
UniProt: D3NZ74
Position
pAB510a:198295..198804
Genome map
AA seq 169 aa AA seqDB search
MSMVILEIPEVRGECRVKTKQVDFTNMILCESLSQDMEVEMEVTTNARRTVHTPKVNNIT
LDRKWDIASPKLISLLLRAGVKGETWKIHCVKPLGDDEFQWVEFLTLELTNPLLAKHSLN
VSEGDTTENLEINATKITWVYKQYDEKQTNQGGGGVSFDLLTGAVGGAS
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgtccatggtcatcctggaaatccccgaggtcaggggcgagtgccgggtcaagacgaag
caggtcgacttcaccaacatgatcctctgcgaatcgctctcgcaggatatggaagtcgaa
atggaagtgacgacgaatgcgcggcgcaccgtccacacgccgaaggtcaacaacatcacg
ctggaccgcaaatgggacattgcgtctcccaagctcatcagcctgttgctgcgggccggc
gtgaagggcgagacatggaagatccattgtgtcaagccgctgggcgacgacgagttccag
tgggtcgagttcctcaccctggagctgaccaacccgcttctggcgaagcactcgctgaac
gtcagcgagggcgacactacggagaacctggagatcaacgccacgaagatcacctgggtc
tacaagcagtacgacgagaagcagaccaaccagggcggcggcggcgtctcgttcgatctg
ctcaccggcgcggtcggcggcgccagctga

DBGET integrated database retrieval system