KEGG   Azospirillum sp. B510: AZL_a01730
Entry
AZL_a01730        CDS       T01169                                 

Definition
(GenBank) hypothetical protein
Organism
azl  Azospirillum sp. B510
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: BAI73704
RhizoBase: AZLa01730
UniProt: D3NZ75
Position
pAB510a:198877..199434
AA seq 185 aa
MQGRAGAGVATLRAIGRQRIGTPAMTQSKAMNGGRTLLFERLIDFEPENPSADDPSMIVM
SMTDLTASIQREIRRLLDSRAAGGRRSDIGGTVMEYGLPDFGDIHPRSFTDRRRVETAVR
HAILDFEPRLLRPRIVVTPGEGNGTLTLEITGEVAAGTVVEPLIFSVNLGAAPLAPTACF
AAGTG
NT seq 558 nt   +upstreamnt  +downstreamnt
atgcagggcagggcaggggcgggcgttgcaacgctccgagcgatcggacgtcaaagaatc
ggaaccccggcgatgacacagtccaaggcgatgaacggcgggcgcacgctgctcttcgag
cgcctgatcgatttcgagccggaaaacccgtcggccgacgatccgtccatgatcgtcatg
tccatgaccgacctgacggcctccatccagcgcgaaatccggcgcttgctggacagccgc
gccgcgggcggacgccggtcggacatcggcggcaccgtgatggaatatgggttgccggac
ttcggcgacatccacccgcgctccttcaccgatcgccgtcgggtggagaccgctgtccgc
catgccatcctcgatttcgagccgcgcctcctccggccgcgcatcgtggtgacgccgggc
gaaggcaacgggacgctgacgctggaaatcacgggtgaagtggccgccggaaccgtcgtc
gaaccgctgatcttttccgtgaatctgggggccgcacccctggcgccaaccgcctgcttc
gccgccgggaccggttga

DBGET integrated database retrieval system