KEGG   Azospirillum sp. B510: AZL_a01770Help
Entry
AZL_a01770        CDS       T01169                                 

Definition
(GenBank) hypothetical protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
azl  Azospirillum sp. B510
Pathway
azl03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:azl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    AZL_a01770
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:azl02044]
    AZL_a01770
Secretion system [BR:azl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   AZL_a01770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_GPD Gp5_C DUF2345 Phage_base_V
Motif
Other DBs
NCBI-ProteinID: BAI73708
RhizoBase: AZLa01770
UniProt: D3NZ79
Position
pAB510a:202897..204990
Genome map
AA seq 697 aa AA seqDB search
MSERFSQAQQHLSISTPLGPDKVILRNIAGEERLSSLFSYRVTMISSDDDIDFDQIVGKP
VTVTLTLGDGTTKRYINAIVGRIELTHIDDRDFTAHYEAELHPWLWMLTHSGDCRIFQEK
TVPEIVEAVIGSAGTIKKVLNGTYPTREYCVQYRETDYNFIARLLEEEGIFYFFEHADGK
HRLVLGDGDSAFTTSSLVSAYEYRGHEAYDNEDNVFTQLGVERRVTTKSVGVDSYHFETP
STDLYAMAEGTSGTGTMNDYAVRHTVSADGEQIALVRQQALAFSGQRIRGGGSCRGLEAG
TKITISGHRKDSLNAEMVLNSVRIEGATNRFVTTFTGFPSAHPFRPFNTARKPRIHSTQT
AKVVGKSGEEIWLDKYGRIKVQFHWDRLGTNDEKSSCWVRVAQGWAGKNYGIMFLPRVGQ
EVVVTFLDGDPDRPLVTGAVYNAEQTVPYTLPDDSTKCTIKTQTSKNGMGKFNEIRFEDK
ADNEEIFVQAQKDMNIKVLHDLTRLVKHDEVETIENDSAIDVKNDRTLTVRNNHSITVSE
GNETHAVSRGTRDLSVKGKETHVNDADFEHSVDKNYALTVKGNLTIDVTGDIVINGKSIK
LTATSADIGIQAATGIGIKAGTSLDVKAGAATTVTSGTNMKIDAGMGATLKGGTTLDLKA
GLALTAEGLSSTVKGAASAEVSGGGMLTLKGGVVMVN
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcgtttctcacaggcccaacagcacctgtcgatctcgactccgttaggaccc
gacaaggtgatcttgcgcaacatcgcgggcgaggaacggctctcgtcgctcttctcctat
cgggtgaccatgatctcgtcggacgacgacatcgatttcgaccagatcgtcggcaagccg
gtgacggtgaccctgacgctgggcgacggcaccaccaaacgctacatcaacgccatcgtc
ggccgcatcgagctgacgcacatcgacgaccgcgatttcaccgcgcattacgaggcggaa
ctgcatccctggctgtggatgctgacccattccggcgattgccgcatcttccaggaaaag
accgtgccggaaatcgtcgaggcggtgataggctccgccggcaccatcaagaaggtgctg
aacggtacctatcccacccgcgaatattgcgttcagtaccgcgagaccgactacaacttc
atcgccaggctgctggaagaggaaggcatcttctatttcttcgagcatgccgacggcaaa
cacaggctggttctgggcgacggcgatagcgcgttcaccacgagttcgctggtctccgcc
tacgagtatcgcgggcacgaggcctacgacaacgaggacaacgttttcacccagctcggc
gtcgagcggcgggtgacgaccaaaagcgtcggggtggacagctatcacttcgagacgccg
tcgaccgacctgtacgccatggcggagggaacatcgggaaccggcacgatgaacgactac
gcggtgcgccacaccgtgtccgccgacggcgagcagatcgccctggtgcgtcagcaggcg
ctggccttctccggtcaacgcatccgcggtggggggagctgccgcgggctggaagccggc
accaagatcaccatctccggccaccgcaaggattcgctcaacgcggagatggtgctgaac
tccgtgcgcatcgagggggcgaccaaccgtttcgtcacgaccttcaccgggttcccctcc
gcccatcctttccgcccgttcaacaccgcgcggaagccgcggatccactcgacccagacc
gccaaggtggtcggcaagtcgggcgaggagatctggctcgacaagtatgggcggatcaag
gtgcagttccattgggaccggctcggcaccaacgacgagaaaagctcctgctgggtccgg
gtcgcgcagggctgggccggcaagaactacggcatcatgttcttgccgcgcgtcgggcag
gaagtcgtggtcaccttcctggacggcgaccccgaccggccgctggtgaccggtgccgtc
tacaacgccgagcagaccgttccctatactctgcccgacgattccacgaagtgcaccatc
aagacgcagacctcgaagaacggcatgggtaagttcaacgagatccgcttcgaggacaag
gccgacaacgaggaaatcttcgtccaggcccagaaggacatgaatatcaaggtcctccac
gacctgactcgcttggtcaagcatgacgaggtcgagacgatcgaaaacgacagcgccatc
gatgtcaagaacgaccggacactgacggtcaggaacaaccattcgatcaccgtgtccgaa
ggcaacgagacccatgcggtttcgaggggcacccgcgacctgtcggtcaagggcaaggag
acgcacgtcaacgacgccgacttcgagcacagtgtcgacaagaactacgcgctgacggtc
aagggcaacctgaccatcgacgtgaccggcgacatcgtgatcaacggcaagtcgatcaag
ctgacggcgacctcggcggacatcggcatccaagcggcgaccggcatcgggatcaaggcc
ggcacgtccctcgacgtgaaggccggcgccgcgacgaccgtgacgtccggcacgaacatg
aagatcgacgccggcatgggcgccacgctcaagggcggcacgacgctggacctgaaagcg
gggctggctctgacagccgaaggcctgtccagcacggtcaagggggcggcgtcggcggaa
gtgagcggtggcggcatgctgacgcttaaaggcggcgtggtgatggtgaactga

DBGET integrated database retrieval system