KEGG   Azospirillum sp. B510: AZL_a02240Help
Entry
AZL_a02240        CDS       T01169                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
azl  Azospirillum sp. B510
Pathway
azl00071  Fatty acid degradation
azl00072  Synthesis and degradation of ketone bodies
azl00280  Valine, leucine and isoleucine degradation
azl00310  Lysine degradation
azl00362  Benzoate degradation
azl00380  Tryptophan metabolism
azl00620  Pyruvate metabolism
azl00630  Glyoxylate and dicarboxylate metabolism
azl00640  Propanoate metabolism
azl00650  Butanoate metabolism
azl00900  Terpenoid backbone biosynthesis
azl01100  Metabolic pathways
azl01110  Biosynthesis of secondary metabolites
azl01120  Microbial metabolism in diverse environments
azl01130  Biosynthesis of antibiotics
azl01200  Carbon metabolism
azl01212  Fatty acid metabolism
azl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:azl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AZL_a02240 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    AZL_a02240 (atoB)
   00640 Propanoate metabolism
    AZL_a02240 (atoB)
   00650 Butanoate metabolism
    AZL_a02240 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AZL_a02240 (atoB)
   00072 Synthesis and degradation of ketone bodies
    AZL_a02240 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AZL_a02240 (atoB)
   00310 Lysine degradation
    AZL_a02240 (atoB)
   00380 Tryptophan metabolism
    AZL_a02240 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AZL_a02240 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AZL_a02240 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AZL_a02240 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:azl04147]
    AZL_a02240 (atoB)
Enzymes [BR:azl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AZL_a02240 (atoB)
Exosome [BR:azl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AZL_a02240 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: BAI73755
RhizoBase: AZLa02240
UniProt: D3NZC6
Position
pAB510a:263104..264285
Genome map
AA seq 393 aa AA seqDB search
MTDSIVIAAAVRTPMGGFQGDLMGLTGPQLGAVAIQAALERAGLAGDAVDEVFMGNVLSA
GLGQAPARQAALGAGLPKGVGCTTISKVCGSGMRAVMFAHDAIKAGSARVVVAGGMESMS
NAPYLLDRARAGYRMGHGKVLDHMFFDGLEDAYDKGRLMGSFAEECATSYGFTREAQDDF
AIESLNRARKAVEDGSFKAEIAPVLVKGRKGDVLVDTDEQPGKGDPKKIPTLKPAFAKDG
TVTAANASSISDGGAALIVTTRSEADRRGLRVIAEIKGHANHAQQPALFTTAPVGAMRTL
FDKVGWSAGDVDLFEINEAFAVVTMAAMRDLDLPHDKVNVHGGACALGHPIGASGARIIV
TLLAGLEKYDLKRGVASLCIGGGEATALAVERV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacagcatcgtcatcgccgccgccgtccgcacgccgatgggcggcttccagggt
gacctcatgggcctgaccggcccgcaactgggcgccgtcgcgatccaggcggcgctggag
cgcgccggcttggccggagacgcggtggacgaggtcttcatgggcaacgtgctgtcggcc
ggtctcggccaggcgccggcacgccaggccgcgctgggcgccgggctgccgaagggggtg
ggctgcaccaccatctccaaggtctgcggctcgggcatgcgggcggtgatgttcgcccat
gacgcgatcaaggccggctcggccagggtggtggtggccggcggcatggagagcatgtcg
aacgccccctatctgctggaccgtgcccgcgccggctaccgcatgggtcacggcaaggtg
ctggaccacatgttcttcgatgggctggaggatgcctatgacaagggccgtctgatgggc
agcttcgccgaggaatgcgcgaccagctacggcttcacccgcgaggcgcaggacgatttc
gccatcgaaagcctgaaccgcgcccgcaaggcggtggaggacggctccttcaaggcggag
atcgcgccggtgttggtcaaggggcgtaaaggggacgtgctggtcgacaccgacgagcag
ccgggcaagggcgatcccaagaagattccgacgctgaagccggccttcgccaaggatggc
acggtgacggcggccaacgcctcgtcgatttcggacggcggtgcggcgctgatcgtcacc
acccggagcgaggcggaccgccgcggcttgcgcgtgatcgccgagatcaagggccacgcc
aatcacgcccagcagccggctttgttcaccacagcgccggttggcgcgatgaggacgctg
ttcgacaaggtgggctggtcggccggcgacgtcgatctgttcgagatcaacgaggcgttc
gccgtggtgaccatggcggcgatgcgcgatctggatctgccgcacgacaaggtgaatgtc
catggcggcgcctgcgcgctcggccatcccatcggcgcctcgggcgcgcgcatcatcgtc
acgctgctggcggggctggagaagtacgacctgaagcggggtgtcgcgtcgctctgcatc
ggtggcggcgaggcgacggcgctcgcggtggagcgggtgtga

DBGET integrated database retrieval system