KEGG   Azospirillum sp. B510: AZL_a02360
Entry
AZL_a02360        CDS       T01169                                 

Definition
(GenBank) secretion protein
  KO
K11003  hemolysin D
Organism
azl  Azospirillum sp. B510
Pathway
azl03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:azl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    AZL_a02360
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:azl02000]
    AZL_a02360
   02044 Secretion system [BR:azl02044]
    AZL_a02360
Transporters [BR:azl02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   AZL_a02360
Secretion system [BR:azl02044]
 Type I secretion system
  alpha-Hemolysin/cyclolysin transporter
   AZL_a02360
SSDB
Motif
Pfam: HlyD_3 HlyD HlyD_D23 Biotin_lipoyl_2 Biotin_lipoyl Cas9_a DUF4472
Other DBs
NCBI-ProteinID: BAI73767
RhizoBase: AZLa02360
UniProt: D3NZD8
Position
pAB510a:281256..282794
AA seq 512 aa
MPRCGGCRPAARRGRRGMVSPEIAEPTGGQAAAPVPSPPPGASASPPSPPPPRQPRPRRG
HELEFLPAALEAVETPPSPLARAVSLLIAAFAVIAVAWAWIGHIDITAVTRGRIISSDRN
KLVQTLETGIVRAIRVADGQRVEQGAVLLELDPTDSAADAGRAEWELAVAETEAARLRAA
LDGRRGFDPAPGADAALVTLQRSILANQLAARDAALDAIGSQERQRRAEMAALAAEKARL
HATLPLIREQVQAKRNLSQRGYSPRFDLLELEKELAEVEFGEVAAANREAEAAAALKGLA
DERRRVTAEFDGKAMADLADAEKRAAALRQELTKAARRRERQLLTAPVGGVIQQLAVHTV
GGVVTAAEPLMVIVPANRTLVADVQVDNKDIGFLHPGMPVEIKIDAFPFTRYGLLPGSVA
SVSHDAILPPDGAAARIGAPDAAPPPAAERDGPKFSARIALDRMVIRGENGEDIALAPGM
AVTAEVKTGRRRILDYLLSPVLAHVQEAMRER
NT seq 1539 nt   +upstreamnt  +downstreamnt
atgccgcgctgtggcggatgcaggccggcggcgcgccgggggaggcggggcatggtgtcg
cctgagatcgccgaaccgacaggcgggcaagccgcggcgccggtgccatctccgccgccg
ggagcgtcggcttcgccgccttccccgccgccgccccgccagccccggccgcgccgcggc
catgagctggagttcctgccggcggcgctggaggcggtggagacaccgccgtcgccgctg
gcgcgggcggtgtcgctgctgatcgccgccttcgcggtgatcgccgtcgcctgggcctgg
atcggccatatcgacatcaccgccgtcacccgcgggcgcatcatctccagcgaccgcaac
aagctggttcagacgctggagaccggcatcgtccgcgccatccgcgtcgccgacggccag
cgggtggagcagggcgccgtcctgctggaactggacccgaccgacagcgccgccgacgcc
ggccgcgccgaatgggagctggcggtggcggagaccgaggcggcgcggctgcgggcggcg
ctggacgggcggcgcggcttcgatccggcgcccggcgccgacgccgccctggtgacgctc
cagcgctcgatcctcgccaaccagctggcggcgcgcgacgcggcgctcgacgccatcggc
agccaggaacgccagcgccgggcggagatggcggcgctggccgccgagaaggcccggctg
catgccaccctgccgctgatccgcgaacaggtgcaggcgaaacggaacctgtcccagcgc
ggctacagtccccgcttcgacctgctggaactggagaaggaactggccgaggtcgaattc
ggcgaggtcgccgctgccaaccgcgaggcggaggccgccgccgcgctgaaggggttggcc
gacgagcggcggcgggtgacggcggagttcgacggcaaggcgatggccgacctcgccgat
gccgagaagcgggccgccgccctgcgccaggagctgaccaaggcggcgcggcggcgcgag
cgccagttgctgacggcaccggtcggcggcgtgatccagcaactggccgttcacacggtg
ggcggggtggtgacggcggcggagccgctgatggtgatcgtgccggccaaccgcaccctg
gtggccgatgtccaggtcgacaacaaggacatcggctttctccatcccggcatgccggtc
gagatcaagatcgacgccttccccttcacccgctacgggctgctgccgggcagcgtcgcc
tcggtgtcgcacgacgccatcctgccgcccgacggggccgccgcacgcatcggcgcgccc
gacgccgccccgccgccggccgccgagcgcgacgggccgaaattctcggcgcgcatcgcg
ctcgaccgcatggtcatccggggcgagaacggcgaggacatcgcgctcgcgcccggcatg
gcggtgacggcggaggtgaagaccggccgccgtcgcatcctcgactacctgctttccccc
gtgctcgcccacgtccaggaggcgatgcgcgagcgctga

DBGET integrated database retrieval system