KEGG   Azospirillum sp. B510: AZL_a03900Help
Entry
AZL_a03900        CDS       T01169                                 

Gene name
metX
Definition
(GenBank) homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
azl  Azospirillum sp. B510
Pathway
azl00270  Cysteine and methionine metabolism
azl00920  Sulfur metabolism
azl01100  Metabolic pathways
azl01110  Biosynthesis of secondary metabolites
azl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:azl00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    AZL_a03900 (metX)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AZL_a03900 (metX)
Enzymes [BR:azl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     AZL_a03900 (metX)
    2.3.1.46  homoserine O-succinyltransferase
     AZL_a03900 (metX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4
Motif
Other DBs
NCBI-ProteinID: BAI73921
RhizoBase: AZLa03900
UniProt: D3NZU2
Position
pAB510a:complement(484791..486197)
Genome map
AA seq 468 aa AA seqDB search
MQSRIVVVRMRREIKENIDTPKAGFVAIRSRYDPAHRRFPPRRRKASRRLEPLPKARSAM
SASPTAPQPFPITPAPDGPAPNDQVMPGQRVRLAVERPMRLDSGIEIGGFQIAYQTYGRL
NADKSNAIFICHALTGDHFVVEKHPVTGKPGWWEMLVGPGKPVDTDRYFVICSNVLGGCL
GSTGPKDIDPATGQPYGLSFPVVTIGDMVRAQKLLVEHLGIEKLFCVIGGSMGGMQVLQW
AVAYPESVFAAVPIATAARHSAQNIAFHEVGRQAIMADPEWRGGNYLLEGTRPEAGLAVA
RMAAHITYLSEAALHRKFGRNLQDRKSITYGFDADFQVESYLRYQGAAFVERFDANSYLY
ITRAMDYFDLAADAGGSLANAFRPGGKTTPVRFCLASFSSDWLFPTSESRAIVHALNAVA
ANVSFVEIETDKGHDAFLLDEPEFHQVIHGFLEGCAEHRGLSVRRRAR
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgcagagccggatagtagtagtccgcatgcgtcgcgaaatcaaagaaaacattgacact
ccaaaggccggcttcgtagctatacgctcccgttacgatccagctcaccgacggtttccg
cccaggcgccgcaaggcctcacgcaggctggaaccgcttcccaaggcacgaagcgccatg
tccgcgtccccgaccgcgccgcagcccttcccgatcaccccggcacccgacggcccggcc
cccaatgaccaggtcatgccgggccagcgcgtgcgtctggcggtggagcggccgatgcgg
ctggacagcggcatcgagatcggcggcttccagatcgcctaccagacctacggcaggctg
aacgccgacaaatccaacgccatcttcatctgccacgccctgaccggcgatcatttcgtc
gtggagaagcacccggtcaccggcaagcccggctggtgggagatgctggtcggccccggc
aagccggtggacaccgaccgctatttcgtcatctgctccaacgtgctgggcggctgcctg
ggcagcaccgggccgaaggacatcgatcccgccaccggccagccctatggcctgtccttc
ccggtggtgaccatcggcgacatggtgcgggcgcagaagctgctggtcgagcatctcggc
atcgagaagctgttctgcgtcatcggcggctcgatgggcggcatgcaggtgctgcaatgg
gcggtggcctatcccgaatcggtgttcgccgcggtgccgatcgccaccgccgcccgccat
tcggcgcagaacatcgccttccacgaggtcgggcgccaggcgatcatggccgacccggaa
tggcgcggcggcaattatctgctggagggcacccggccggaggccggtctggccgtcgcc
cgcatggccgcccatatcacctacctgtcggaagcggcgctgcaccgcaagttcggccgc
aatttgcaggaccgcaagtcgatcacctacgggttcgacgccgatttccaggtcgagagc
tatctgcgctaccagggggcggccttcgtcgagcggttcgacgccaattcctacctctac
atcacccgggcgatggattatttcgacctcgccgccgatgcgggcggatcgctggccaac
gccttccggccgggcgggaagaccacgccggtgcgcttctgcctcgccagcttctccagc
gactggctgttcccgacctccgaatcgcgggccatcgtgcatgcgctgaacgccgtcgcc
gccaatgtcagcttcgtggagatcgagaccgacaagggccatgacgccttcctgctggac
gagccggagttccatcaggtcatccacggcttcctggagggctgcgccgaacatcgcggc
ctgtccgtccgccgccgcgcgcgctga

DBGET integrated database retrieval system