KEGG   Azospirillum sp. B510: AZL_a05020Help
Entry
AZL_a05020        CDS       T01169                                 

Definition
(GenBank) hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
azl  Azospirillum sp. B510
Brite
KEGG Orthology (KO) [BR:azl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:azl02044]
    AZL_a05020
Secretion system [BR:azl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   AZL_a05020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VipB
Motif
Other DBs
NCBI-ProteinID: BAI74033
RhizoBase: AZLa05020
UniProt: D3P054
Position
pAB510a:620456..621940
Genome map
AA seq 494 aa AA seqDB search
MATDTERQSTAAPTTTDEPSLLDQIMEQTRLRPVDEGYDLAKRGIEAFVSELMKPTRKDE
KVNNAIVDQMIAEIDAKLGRQIDTILHDDGFQKLETAWRGLKFLVDRTDFRENIKIEVLS
ATKDELREDFEDAPEIAKSGLYKQVYVSEYGQFGGQPIGAVITNFEYSPNAADVKLMQNM
AAVGAMSHTPVIGAAGPQFFGNDSYEALPNLKDLQSIFDSPSYAKWNSFRESEDSRYFGL
TLPRFLLRLPYGPQSTPIKSFNYQESASTDSKDYCWGNAAFAFATRLSESFAKYRWCPNI
IGPQSGGVVEDLPLHRFDAMGQTETKIPTEILISDRREYELAEQGFIALTMRKGSDNAAF
FSANSVQKPKSFGSSKEGKEAELNYKLGTQLPYLFIINRLAHYIKVLQRENIGSWKQRGE
LETELNNWIRDYVSDQDNPTAEVRSRRPLRRAKIVVEEVEGDVGWYRVNLKVQPHFKHMG
ADFTLNLTGKLDKV
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgataccgaacgacaatccacggcggccccgaccacgacggacgaaccgtcg
ctgctcgaccagatcatggaacagacccgtctgcgcccggttgacgagggctatgacctt
gccaagcgcggcatcgaagccttcgtgtcggagctgatgaagccgacccgcaaggacgag
aaggtgaacaacgccatcgtcgatcagatgatcgcggagatcgacgccaagctcggccgg
cagatcgacacgatcctgcatgacgacggtttccagaagctggaaacggcatggcgcggc
ctgaagtttctggtcgaccgcaccgacttccgcgagaacatcaagatcgaggtgctgtcc
gccaccaaggacgagcttcgcgaggatttcgaggacgcgcccgagatcgccaagtccggc
ctctacaagcaggtctatgtgtcggagtacggccagttcggcggccagccgatcggcgcg
gtgatcaccaacttcgaatacagccccaacgccgcggacgtgaagctgatgcagaacatg
gccgctgtcggcgccatgtcccacacgccggtgatcggtgccgccggtccgcagttcttc
ggcaatgacagctatgaggcgctgccgaatctgaaggatctccagtcgatcttcgacagc
ccgagctacgccaagtggaactccttccgggagtccgaggattcccgctatttcggcctg
accctgccgcgcttcctgctgcgcctgccctacggcccccagagcacccccatcaaatcc
ttcaactaccaggaatcggcgtccaccgattccaaggattactgctggggcaacgccgcc
ttcgccttcgcgacccgcctgtcggaaagcttcgccaaataccgctggtgtccgaatatc
atcgggccgcagagcggtggcgtggtcgaggatctgccgcttcaccgcttcgacgcgatg
gggcagaccgaaaccaagattccgacggagatcctgatctccgaccgccgcgagtatgaa
ttggcggaacagggcttcatcgccctgaccatgcgcaagggcagcgacaacgccgccttc
ttctcggccaactcggtgcagaagcccaagagcttcggcagttccaaggaaggcaaggag
gctgaactgaactacaagcttggcacccagcttccgtatctcttcatcatcaaccggctt
gcccactacatcaaagtgctccagcgcgagaacatcggaagctggaagcagcgcggagag
ctggaaaccgagttgaacaactggatccgcgattatgtctccgaccaggacaatccgacc
gccgaggtccgcagccgccgtccgctgcgccgcgccaagatcgtggtggaggaggtcgag
ggggatgtcggctggtatcgcgtcaacctgaaggtccagccgcacttcaagcatatgggg
gcggatttcaccctgaatctgaccggcaagctcgacaaggtctga

DBGET integrated database retrieval system