KEGG   Azospirillum sp. B510: AZL_a05110Help
Entry
AZL_a05110        CDS       T01169                                 

Definition
(GenBank) hypothetical protein
  KO
K11892  type VI secretion system protein ImpK
Organism
azl  Azospirillum sp. B510
Pathway
azl03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:azl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    AZL_a05110
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:azl02044]
    AZL_a05110
Secretion system [BR:azl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   AZL_a05110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DotU DUF3040 DUF4381
Motif
Other DBs
NCBI-ProteinID: BAI74042
RhizoBase: AZLa05110
UniProt: D3P063
Position
pAB510a:complement(631731..632711)
Genome map
AA seq 326 aa AA seqDB search
MSQFIDEDDAPTTPRPIQVPPPPRPAVPGRPQPPTPASPRIAAPQRPAAPQALLQRRPPA
ADPTAMPARGRDGGTNALLTAAGPLLTMVTQVAFSSEHADADALQRGFLAAFTRFETEAA
AAGYREDTVTTAKYVLAALVDEMVLDTGWGFESVWGSRSLLSLLFRETWGGEKVFTILDR
LKAEPDRNIDALELIGRCLAFGFQGKYRRLDGGLYQLEDLRSELDRLCRSLRPAVDPRLA
STVAPVKAATRLRRFLPGWVVFVLVAVLLAGAFLSAKGKLNQRAEAALASLARVAGAGTA
AGAAAVPARAPAFLPAAPNPSPLTAR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgagccagttcatcgacgaggacgacgccccgaccacaccgcggccgatccaggttcca
ccgccgccgcgtccggcggtgccgggccgaccgcagcccccaacgccggcatcgccacgc
atcgccgcgccacagcgtccggccgccccccaggcgctcctccaacggcggcctccggcg
gccgacccgacggcgatgcccgcgcgcggccgtgacggcggcaccaacgcgttgctgacg
gcggccggaccgctgctgacgatggtcacgcaagtcgccttttccagcgagcatgccgac
gccgacgccttgcagcgcggattcctggccgccttcacccgcttcgaaaccgaagccgcc
gccgccggatatcgcgaagacaccgtgaccacggcgaaatacgtgctggccgccctggtg
gacgagatggtgctcgataccggatggggtttcgaaagcgtgtggggaagccgcagcctg
ctgtccctcctgttcagggagacctgggggggtgagaaggtgttcaccatcctcgaccgg
ctgaaggccgaaccggaccgcaacatcgacgcgctggaactgatcggccgctgcctggcg
ttcggtttccagggcaaataccggcggctggacggtggcctctaccagctcgaggatctg
cgaagcgagcttgaccgcttgtgccgcagcctgcgtcccgccgtcgacccgcggctcgcc
tccaccgtggctccggtgaaagccgcgacccggctgcgccggttcctgccgggctgggtg
gtgttcgtcctggtcgcggtgctgctcgccggcgccttcctgtccgcgaagggcaagctg
aaccagagggccgaagccgccctcgccagcctcgcccgcgtggccggcgccggaaccgcc
gccggagccgccgccgtgcccgcccgcgcaccggccttccttccggccgccccgaatccc
agcccgctgaccgcccgatga

DBGET integrated database retrieval system