KEGG   Azospirillum sp. B510: AZL_d03020Help
Entry
AZL_d03020        CDS       T01169                                 

Definition
(GenBank) protein-glutamate methylesterase, two-component response regulator, chemotaxis
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
azl  Azospirillum sp. B510
Pathway
azl02020  Two-component system
azl02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:azl00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AZL_d03020
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    AZL_d03020
Enzymes [BR:azl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     AZL_d03020
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     AZL_d03020
Two-component system [BR:azl02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   AZL_d03020
Bacterial motility proteins [BR:azl02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    AZL_d03020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg TAL_effector
Motif
Other DBs
NCBI-ProteinID: BAI76128
RhizoBase: AZLd03020
UniProt: D3P649
Position
pAB510d:complement(348256..349422)
Genome map
AA seq 388 aa AA seqDB search
MSDSLGRGPLTTARPANPDPVRVMVVDDSAVIRGLLTRALEGDPEIRVVTSVGDGQMAVS
SLQRNSIDVIVLDIEMPVMDGLTAIPKLLAVAPQVKIIMASTLTLRGADVSLRCLSAGAA
DYIPKPTSTREIGGAEDFKRELVAKVKALGAAARRAGSRSRGEIRPLTPASPIGLLKREV
GPIVTRPTPAGAIATKPDVIAIGSSTGGPQALFEVLSHLKAGVSQPILITQHMPATFTTI
LAEHITRQCGIDAREAKDGEPIVQNRCYIAPGDFHMLVAQRAGANVITLSKDPPENFCRP
AVDPMMRSILKAFGGRKILACILTGMGQDGLKGCTDVVNGGGTLIAQDEASSVVWGMPGA
VAQAGICNAILPLKEIGPHIRKLASRAA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacagtttaggcagaggtcccctcaccaccgcgcgaccggccaatccggatccc
gtccgggtcatggtggtggacgactccgccgtcatccgtggcctgctgacccgcgcgttg
gagggggacccggagatccgcgtcgtcacctccgtcggcgatggccagatggcggtcagt
tcgttgcagcgcaattcgatcgacgtcatcgtcctcgacatcgagatgccggtgatggac
gggctgaccgccattccgaagctgctggcggtggcgccccaggtcaagatcatcatggcc
tcgacgctgacgctgcgcggggccgatgtttcgctgcgctgcctgtccgccggtgccgcc
gactatatcccgaagccgacctccacccgcgagatcggcggggcggaggatttcaagcgc
gagctggtcgccaaggtcaaggcgctgggcgccgccgccaggcgcgccgggtcgcggtcg
cgcggcgagatccgtccgctgaccccggcgtcgcccatcggtctgctgaagcgcgaggtc
gggccgatcgtcacccgtccgactccggccggggccatcgcgaccaagcccgacgtgatc
gccatcggcagctcgaccggcggcccgcaggcgctgttcgaggtgttgtcgcacctgaag
gccggcgtcagccagccgatcctgatcacccagcacatgccggcgaccttcaccaccatc
ctggccgagcatatcacccgccaatgcggcatcgatgcgcgcgaggccaaggacggcgag
ccgatcgtgcagaaccgctgctacatcgcgcccggcgacttccacatgctggtggcgcag
cgcgcgggggcgaacgtgatcacgctcagcaaggatccgccggagaatttctgccgcccg
gcggtcgatccgatgatgcggtcgatcctgaaggccttcggtggccgcaagatcctggcc
tgcatcctgaccggcatgggtcaggacgggctgaagggctgcaccgacgtggtcaatggc
ggcggtaccctgatcgcccaggacgaggcgtcgagcgtggtctggggcatgccgggtgcg
gtggcgcaagccggcatctgcaacgccatcctgccgctcaaggaaatcggtccccacatc
cgcaagctcgcgtcgagggcagcatga

DBGET integrated database retrieval system