KEGG   Azospirillum sp. B510: AZL_e01840Help
Entry
AZL_e01840        CDS       T01169                                 

Gene name
dapE
Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
azl  Azospirillum sp. B510
Pathway
azl00300  Lysine biosynthesis
azl01100  Metabolic pathways
azl01120  Microbial metabolism in diverse environments
azl01230  Biosynthesis of amino acids
Module
azl_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:azl00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    AZL_e01840 (dapE)
Enzymes [BR:azl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     AZL_e01840 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: BAI76529
RhizoBase: AZLe01840
UniProt: D3P7A0
Position
pAB510e:complement(237440..238747)
Genome map
AA seq 435 aa AA seqDB search
MHSDTANTATGQLFGRIEAKRDDLVALTQALIRIPTVNPPGDAYTDCALLIGRRLAARGF
TVEYVRAEGAAGDSDRYPRTNIVARIEGPRPGPCVHFNGHIDVVPAGQGWTVDPFAGVVK
DGRVYGRGACDMKGGIAASIVAVESLLEEGLLTAGALEISGTVDEESGGYGGVGHLATLG
YFSRPRVDHVIIPEPLNVDRVCIGHRGVWWAEIETRGRVAHGSMPFLGNCAVRHMGAVLH
RIETELLPRLAVKRTAMPVVPEGARQSTININAIHGGQREDHDGLPSPMVPDRCRMVIDR
RYLIEEDPEAVRGEIVAILEDLRRNRPGFDYELREVLAFLPTMTDADAPVVRAVAAAIET
VLGRPARQVVSPGTYDQKHVVRIGNLKDCIAYGPGILDLAHQPDEWVGIDDMVKAAQVMA
LATLGLLEGDGGSRF
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgcactccgacaccgccaacaccgccaccggccaactgttcggccgtatcgaggcgaag
cgcgacgatctggtcgcgctgacgcaggcgctgatccgcattccgaccgtcaacccgccc
ggcgacgcctacaccgactgcgccctgttgatcggccggcggctggcggcgcgcggcttc
accgtggaatatgtgcgggcggagggggcggccggcgacagcgaccgctatccccgcacc
aacatcgtcgcccgcatcgaaggcccccggccggggccttgcgtccatttcaacggccat
atcgacgtggtgcccgccggccagggctggaccgtcgatcccttcgccggggtggtgaag
gatggccgggtctatggccgcggcgcctgcgacatgaagggcggcatcgccgcgtcgatc
gtcgccgtggaatcgctgctggaggaaggtctgctcaccgccggcgccctggagatctcc
ggcacggtggacgaggaatccggcggctatggcggtgtcggccatctggcgacgcttggc
tatttctcgcggccaagggtggaccatgtcatcattccggaaccgctgaacgtcgaccgc
gtctgcatcggccatcgcggcgtctggtgggcggagatcgagaccaggggccgcgtcgcc
cacggctccatgcccttcctcggcaactgcgcggtacgccacatgggcgccgtgctgcac
cggatcgaaacggagctgctgccccgcctcgccgtcaagcgcaccgccatgccggtggtg
ccggagggcgcgcgccaatccaccatcaacatcaacgccatccatggcggccagcgcgag
gaccatgacgggctgcccagcccgatggtgcccgaccgctgccgcatggtgatcgaccgc
cgatacctgatcgaggaggatcccgaggcggtccgcggcgagatcgtcgccatcctggag
gatctgcgccgcaaccgtcccggcttcgactatgaactgcgggaggtgctggccttcctg
ccgaccatgaccgacgccgacgcccccgtcgtccgcgcggtggccgccgccatcgagacg
gtgctcggccgcccggccaggcaggtggtttcccccggcacctatgaccagaagcatgtg
gtgcggatcggcaacctgaaggactgcatcgcctacggccccggcatcctcgacctcgcc
caccagcccgacgagtgggtcggcatcgacgacatggtcaaggcggcgcaggtgatggcg
ctggcgacactggggctgctggagggcgacggcgggtcgcgcttctga

DBGET integrated database retrieval system