KEGG   Azospirillum sp. B510: AZL_e03560Help
Entry
AZL_e03560        CDS       T01169                                 

Gene name
galM
Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
azl  Azospirillum sp. B510
Pathway
azl00010  Glycolysis / Gluconeogenesis
azl00052  Galactose metabolism
azl01100  Metabolic pathways
azl01110  Biosynthesis of secondary metabolites
azl01120  Microbial metabolism in diverse environments
azl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:azl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AZL_e03560 (galM)
   00052 Galactose metabolism
    AZL_e03560 (galM)
Enzymes [BR:azl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     AZL_e03560 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: BAI76701
RhizoBase: AZLe03560
UniProt: D3P7S2
Position
pAB510e:complement(450160..451191)
Genome map
AA seq 343 aa AA seqDB search
MPIESFLFDTVDGRPVEGFVLSAGGLEATVIAHGARLLRMMVPGRDGEPADVVLGFDRLA
DYLASDAYFGATCGRYGNRIGGAAFTLDGVRHALAVNEPPNQLHGGPEGFDRRIWEAHVE
EAENAVTFTLVSPDGDQGYPGTLTATTRYRLTGDGVLDIRMTATSDRPTIVNLVHHSYWN
LGGHASGDLGDHRLAVRGGFTTPVGADLIPTGEVRPVDGTPFDLRDGVLLGEALAAVGGF
GFDHNWCLEGPAGELRPVAVLEHPASGRRMELATDQPGLQIYSGGYLSERVVGKGGRPYR
RFAGLALETQRFPGSPNIGHFPSTRLDPGETYSHTMRLRFSAG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcgagagtttcctgttcgatacggtcgatggccggccggtggaggggttcgta
ctttccgccggcgggctggaggcgacggtgatcgcccatggcgcccggctgttgcggatg
atggtgcccggccgtgacggtgagccggccgacgtggtgctgggcttcgaccgcttggcc
gattatctggcgagcgacgcctatttcggcgccacctgcggccgctatggcaaccgcatc
ggcggggccgccttcacgctggacggcgtgcgccacgcgctggccgtcaacgagccgccc
aaccagctgcatggcggacccgaagggttcgatcggcgaatctgggaggcgcacgtggag
gaggcggagaacgccgtcaccttcacgctggtctcgcccgacggcgaccagggctatccg
ggaacgctgaccgcgaccacgcgctaccggctgaccggcgacggcgttctggacattcgc
atgacggcgacaagcgaccgtccgaccatcgtcaacctcgtccatcacagctattggaac
ctcggggggcatgcgtcgggtgacctcggcgaccaccggctggcggtgcgcggcggcttc
accacgccggtcggcgccgacctgatcccgaccggggaggtgcggccggtggacggcacg
ccgttcgacctgcgcgacggcgttctgctgggcgaggcgctggcggcggtcggcggcttc
ggcttcgaccacaactggtgcctggaggggccggcgggcgagctgcggccggtggcggtg
ctggagcatccggcatcgggccggcggatggagctggcgaccgaccagcccggcttgcag
atctacagcggcggctatctcagcgagagggtggtgggcaagggcgggcggccttatcgc
cgcttcgccggtctggcgctggagacccagcgctttcccggcagcccgaacatcggccat
ttcccctcgacccggctcgatccgggggagacctacagccacaccatgaggttgcgcttt
tcggccggctga

DBGET integrated database retrieval system