KEGG   Azospirillum sp. B510: AZL_e03620Help
Entry
AZL_e03620        CDS       T01169                                 

Definition
(GenBank) ketoglutarate semialdehyde dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
azl  Azospirillum sp. B510
Pathway
azl00040  Pentose and glucuronate interconversions
azl00053  Ascorbate and aldarate metabolism
Brite
KEGG Orthology (KO) [BR:azl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AZL_e03620
   00053 Ascorbate and aldarate metabolism
    AZL_e03620
Enzymes [BR:azl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     AZL_e03620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: BAI76707
RhizoBase: AZLe03620
UniProt: D3P7S8
Position
pAB510e:complement(457537..459117)
Genome map
AA seq 526 aa AA seqDB search
MTITGEMLIGASAHRGGQGAFRAVDPSTGEALEPAFGGGGVAEVERACALAWAAFDAFRE
TGLERRAAFLETIAQAILDIGDELIVRAMAETGLPRARLEGERGRTVGQLRLFAQVVREG
GWIEARIDPAQPARAPLPRADLRQRHIALGPVAVFGASNFPLAFSVAGGDTASALAAGCP
VVVKGHGAHPGTSELVGRAVQAAVASCSLPEGVFSLLFGNGREIGTALVADPRIKAVGFT
GSRGGGLALMGVAARRPEPIPVYAEMSSINPVFLMPAALASRAEALGKGFVASLTMGAGQ
FCTNPGILLGVEGPELDRFVAAAVEALGGSAASTMLTPGIHAAFDSGVARLAGSGAVATL
ARGLACNGPNQAQAAFFTTTADAFLADSGLQEEVFGAASLLIRCKDVAAMVAVAERLEGQ
LTATLQMDAADKAAVAGLIPTLERKAGRLLANGWPTGVEVCHAMVHGGPFPATSDPRGTS
VGTLAIRRFLRPVCYQDIPADLLPVPLRDGNPLGLWRRVDGTLGKD
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcaccggcgagatgctgatcggcgcttcggcgcatcgcggcggccagggcgcg
ttccgcgccgtcgacccctccaccggcgaagcgctggagcctgccttcggcggcggcggc
gtggccgaggtggagcgcgcctgcgcgctggcctgggccgccttcgacgccttccgcgaa
accgggctggagcggcgcgccgccttcctggagaccatcgcccaggccatcctcgacatc
ggcgacgagctgattgtccgcgccatggccgagaccggcctgccgcgcgcccggctggag
ggcgagcgcggccgcaccgtcggccagctccgcctgttcgcccaggtcgtgcgcgagggc
ggctggatcgaggcccgcatcgacccggcgcagccggcccgcgcgccgctgccgcgcgcc
gacctgcgccagcgccacatcgcgctggggccggtcgcggtgttcggcgcgtcgaacttc
ccgctcgccttctcggtggccggcggcgacaccgcgtcggcgttggccgccggctgcccg
gtggtggtcaagggccatggcgcccatcccggcacctccgagctggtcggccgcgccgtc
caggcggcggtggcgtcctgcagcctgcccgaaggcgtcttctcgctgctgttcggcaat
ggacgggagatcggcacggcgctggtcgccgatccgcgcatcaaggcggtcggcttcacc
ggctcgcgcggcggcgggctggcgctgatgggggtggcggccaggcggcccgagccgatc
ccggtctatgccgagatgagcagcatcaacccggtcttcctgatgccggcggcgctggcc
tcgcgggccgaggcgctgggcaagggcttcgtcgcctcgctgaccatgggagccgggcag
ttctgcaccaaccccggcatcctgctgggcgtggaggggccggagctcgaccgcttcgtc
gcggcggcggtggaggctctcggcggcagtgccgcgtcgaccatgctgacgccgggcatc
catgccgccttcgacagcggcgtcgccaggctggccggcagcggcgcggtggcgacgctg
gcgcgcggtctggcctgcaacgggccgaaccaggcgcaggcggccttcttcaccacgacg
gcggacgccttcctggccgacagcgggttgcaggaggaggtcttcggcgccgcctcgctg
ctgatccgctgcaaggacgtggcggcgatggtggcggtcgccgaaaggctggaaggacag
ctgacggcgaccttgcagatggacgcggcggacaaggcggcggtggccgggctgatcccg
acgctggagcgcaaggccggtcggctgctggcgaacggctggccgaccggggtcgaggtc
tgccacgccatggtgcatggcggcccgttcccggcgacgtcggacccgcgcggcacctcg
gtcggcacgctggcgatccgccgcttcctccgtccggtctgctaccaggacatccccgcc
gacctgctgccggtgcccttgcgcgacggcaacccgctgggcttgtggcgccgcgtcgat
gggacgctcggcaaggattga

DBGET integrated database retrieval system