KEGG   Azospirillum sp. B510: AZL_e03630Help
Entry
AZL_e03630        CDS       T01169                                 

Gene name
dapA
Definition
(GenBank) dihydrodipicolinate synthase
  KO
K13876  2-keto-3-deoxy-L-arabinonate dehydratase [EC:4.2.1.43]
Organism
azl  Azospirillum sp. B510
Pathway
azl00053  Ascorbate and aldarate metabolism
azl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:azl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    AZL_e03630 (dapA)
Enzymes [BR:azl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.43  2-dehydro-3-deoxy-L-arabinonate dehydratase
     AZL_e03630 (dapA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHDPS Asp_protease_2
Motif
Other DBs
NCBI-ProteinID: BAI76708
RhizoBase: AZLe03630
UniProt: D3P7S9
Position
pAB510e:complement(459175..460101)
Genome map
AA seq 308 aa AA seqDB search
MPSSARPYRGVFPVVPTIFTESGDLDLDGQKRCVDFMIDAGSTGLCILANFSEQFVLTDD
ERTTLMETMLAHVAGRVPVIVTTTHFSTRACAERSRRAQDLGAAMVMVMPPYHGATIRVP
EAGIVEFFNRVSDAIDIPIMIQDAPVSGTTLSAPLLARMAREIANVSYFKIEVPQAAAKL
RTLIELGGDAIEGPWDGEEAITLLADLDAGATGAMTGGGYPDGIRQIVDPYLAGDREAAV
AAYGRWLPLINHENRQCGIATAKILMKEGGIIASDAMRHPVANPHPISRAGLLDAAKRLD
PLVLRWGR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgccgtccagcgcccgcccttatcgtggcgtcttccccgtcgttcccaccatcttcacc
gagtcgggagacctggacctcgacggccagaagcggtgcgtcgatttcatgatcgacgcc
gggtcgaccggtctgtgcatcctcgccaacttctccgaacagttcgtgctgaccgacgac
gagcgcacgacgttgatggagacgatgctggcccatgtcgccggccgggtgccggtgatc
gtcaccaccacccatttcagcacccgcgcctgtgccgagcgcagccgccgcgcccaggat
ctgggggcggcgatggtgatggtgatgccgccctaccatggcgccaccatccgcgtgccg
gaggccggcatcgtcgagttcttcaaccgtgtgtcggacgccatcgacatcccgatcatg
atccaggacgcgccggtcagcggcaccacgctgtcggcgcccctgctggcgcggatggcg
cgggagatcgccaacgtctcctatttcaagatcgaggtgccgcaggcggcggccaagctg
cgcaccctgatcgagctgggcggcgacgccatcgaggggccgtgggacggcgaggaggcg
atcaccctgctggcagacctcgatgccggcgccaccggcgcgatgaccggcggcggctat
cccgacggcatccgccagatcgtcgatccctatctggccggcgaccgcgaggcggcggtg
gcggcctatggccgctggctgccgctgatcaaccatgagaaccgccagtgcggcatcgcc
accgccaagatcctgatgaaggagggcggcatcatcgcgtccgacgcgatgcgccacccg
gtggccaacccgcacccgatcagccgtgccggactgctggacgcggcgaagcggctcgat
ccgctggtgttgcgctggggccggtga

DBGET integrated database retrieval system