KEGG   Azospirillum sp. B510: AZL_e03640Help
Entry
AZL_e03640        CDS       T01169                                 

Definition
(GenBank) gluconolactonase
  KO
K14274  xylonolactonase [EC:3.1.1.-]
Organism
azl  Azospirillum sp. B510
Pathway
azl00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:azl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AZL_e03640
Enzymes [BR:azl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-  
     AZL_e03640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SGL
Motif
Other DBs
NCBI-ProteinID: BAI76709
RhizoBase: AZLe03640
UniProt: D3P7T0
Position
pAB510e:complement(460176..461066)
Genome map
AA seq 296 aa AA seqDB search
MAQEARCVWQARALLGEGPLWSPRQDAVYFVDIRGARILRHGLSDGSQAVWELDDAACWL
VEDADGDGFVAGLRSRRVVRLRLEPGRALIGGEIARIEPDKPGNRLNDGKADRAGRLWIG
SMDDSEEAPAGGFYRIDADGAVTRVDEGYTVANGPALAPDGRTIYHTDSAARTVYAFDIG
ADGGLSDGSLSGKRVHIRFGEADGYPDGMTCDAEGGLWVCHWDGGRVSRFHPDGTFDRAI
ALPVSRVTSCVFAGPDLDRLFITTAAHGRPEEPLAGALFECDPGVRGLPPGRFGTP
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaggaagcgcggtgtgtctggcaggccagggcgctgctgggggaggggccgctg
tggtccccgcggcaggacgcggtttacttcgtcgacatccgcggcgcgcggatcctgcgc
catggcctgtccgacggctcgcaggccgtgtgggagctggatgacgccgcctgctggctg
gtcgaggatgccgacggcgacggtttcgtcgccggcctgcgctcgcgccgcgtcgtccgc
ctgcggctggagccgggacgtgcgctgatcggcggggagatcgcccggatcgagccggac
aagccgggcaaccggctgaacgacggcaaggccgaccgcgccggccggctgtggatcggc
agcatggacgattcggaggaggcgccggccggcggtttctaccggatcgacgccgacggc
gccgtcacccgggtcgacgagggctataccgtcgccaacgggccggcgctggcgcccgac
gggcgcacgatttaccacaccgacagcgcggcgcggacggtctacgccttcgatatcggc
gccgatggcggcctgtcggacggcagcctgtcgggcaagcgcgtccacatccgcttcggc
gaggccgacggctatcccgacggcatgacctgcgacgccgagggcgggctgtgggtctgc
cattgggatggtgggcgggtcagccgcttccatcccgacgggacgttcgaccgggcgatc
gcgctgccggtttcccgcgtcacctcctgtgtcttcgccggtccggacctcgaccggctg
ttcatcaccaccgcggcgcacggccggcccgaggagcccttggccggggcgctgttcgag
tgcgaccccggcgtccgcggcctgccgcccggacgcttcggcaccccatag

DBGET integrated database retrieval system