KEGG   Azospirillum sp. B510: AZL_e03650Help
Entry
AZL_e03650        CDS       T01169                                 

Definition
(GenBank) HTH-type transcriptional regulator
Organism
azl  Azospirillum sp. B510
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1
Motif
Other DBs
NCBI-ProteinID: BAI76710
RhizoBase: AZLe03650
UniProt: D3P7T1
Position
pAB510e:461251..462252
Genome map
AA seq 333 aa AA seqDB search
MTPQRFSPNWFQKARLKLRHLQLFAALDEHRNLHRAAASLNMSQPAASKLLGDLEETLGI
ELFDRHGRGIEPNWYGSMMIRHARMILSELQETGEELNALLAGHSGRVSIGTVMAPAVEL
VVPVISGLTRDHPNLKVAVAVETSDVLAERVRQGVMDFAIGRLPGHFDPTAFEYQEISSE
ELCFISREGNPLLTLGRPLTAADLSDATWILQPVGTLLRDRVEALFRAEGARLPHRVIES
ASPVISMAMVAETDSVTVFARALAQVFSPSGCCAIMPFHKRFSVEPYGIFWLRDRPLSPG
ARTVLSAVRAASERKMRQSPTPSPTPATVAAPA
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
gtgactccccaacgcttttcgccgaactggttccagaaggcgcggctgaagctgcgccat
ctccagctcttcgcggcgctcgacgagcatcgcaacctgcaccgcgccgccgccagcctg
aacatgtcgcagcccgccgcctccaagctgctgggcgatctggaggagacgctggggatc
gagctgttcgaccgccatggccgcgggatcgagccgaactggtacggcagcatgatgatc
cgccatgcccggatgatcctcagcgaattgcaggagaccggggaggagctgaacgccctg
ctcgccgggcacagcggccgcgtgtccatcggcacggtgatggctccggcggtggagctg
gtggtgccggtgatcagcggcctgacccgcgaccatcccaacctgaaggtggcggtggcg
gtggagaccagcgatgtgctggccgagcgcgtccgccagggggtgatggatttcgccatc
ggccgcctgcccggccatttcgaccccaccgccttcgaatatcaggagatcagcagcgag
gagctgtgcttcatctcccgcgagggcaacccgctgctgacgctcggccgccccctgacc
gccgccgatctctccgacgccacctggattctccagcccgtcggcacgctgctgcgcgac
cgggtggaggcgctgttccgcgccgagggcgcccgcctgccgcacagggtgatcgaaagc
gcctctcccgtcatctcgatggcgatggtggcggaaaccgattcggtcaccgtcttcgcc
cgcgcgctggcccaggtcttctcgcccagcggctgctgcgccatcatgcccttccacaaa
cgcttcagcgtcgagccctacggcattttctggctgagggaccggccgctttcgcccggc
gcgcgcaccgtgctgtccgccgtgcgcgcggcgtcggaacgcaagatgcgccaatcccca
accccatccccaacccccgccaccgtcgcggcgcccgcctga

DBGET integrated database retrieval system