KEGG   Azospirillum sp. B510: AZL_e03660Help
Entry
AZL_e03660        CDS       T01169                                 

Gene name
chvE
Definition
(GenBank) multiple sugar transport system substrate-binding protein
  KO
K10546  putative multiple sugar transport system substrate-binding protein
Organism
azl  Azospirillum sp. B510
Pathway
azl02010  ABC transporters
Module
azl_M00216  Multiple sugar transport system
Brite
KEGG Orthology (KO) [BR:azl00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    AZL_e03660 (chvE)
Transporters [BR:azl02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Multiple sugar transporter [MD:M00216] [OT]
    AZL_e03660 (chvE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_4 Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: BAI76711
RhizoBase: AZLe03660
UniProt: D3P7T2
Position
pAB510e:462420..463508
Genome map
AA seq 362 aa AA seqDB search
MSSAKRTSFSSKFAGLAVGLLVVAGAAVPAMAQDKPTVGIAMPTKSSARWIDDGNNMVKY
FQEKGYKTDLQYAEDDIPNQLAQIENMVTKNDKILVIAAIDGTTLTDVLQKAAERGVKVI
AYDRLIRGSANVDYYATFDNFQVGVLQASYIEKALGLKEGKGPFNIELFGGSPDDNNAYF
FYNGAMSVLQPYIDSGKLKVGSGQVGMDKVSTLRWDGAVAQARMDNLLSAYYGNKRVDAV
LSPYDGLSIGIISSLKGVGYGSASQPMPVVTGQDAEVQSVKSILAGEQRSTVFKDTRELA
KVTVGMVDDLLAGRTPQVNDTKTYDNGKKIVPSYLLKPVSVDASNWKQVLVDGGYYKESQ
IK
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccgctaagcgtacttccttcagctcgaaattcgccggcctcgccgtcggcctc
ctggtcgtcgccggcgccgccgtcccggccatggcccaggacaagccgacggtcggcatc
gccatgccgaccaagtcgtccgcccgctggatcgacgacggcaacaacatggtcaagtat
ttccaggaaaagggatacaagaccgacctgcaatatgcggaggacgacatccccaaccag
ctcgcccagatcgagaacatggtcaccaagaacgacaagattctggtgatcgccgccatc
gacgggacgacgctgaccgacgtgctgcagaaggcggcggagcggggcgtgaaggtcatc
gcctacgaccgcctgatccgcggctcggccaatgtcgactattacgccaccttcgacaat
ttccaggtcggcgtcctccaggcctcctacatcgagaaggcgctcggtctgaaggagggc
aagggcccgttcaacatcgagctgttcggcggctcgcccgacgacaacaacgcctatttc
ttctacaacggcgccatgtcggtgctgcaaccctacatcgacagcggcaagctgaaggtc
ggcagcggccaggtcggcatggacaaggtgtcgaccctgcgctgggacggcgccgtcgcc
caggcccgcatggacaatctgctgagcgcctattacggcaacaagcgggttgacgccgtg
ctgtcgccctatgacgggctgagcatcggcatcatctcctcgctgaagggcgtgggctac
ggctcggcctcgcagccgatgccggtcgtcaccggccaggacgccgaggtgcagtcggtc
aagtcgatcctggcgggcgagcagcgttccaccgtcttcaaggacacccgcgaactggcg
aaggtcacggtgggcatggtcgacgacctgctggccggccgcaccccgcaggtcaacgac
accaagacctacgacaacggcaagaagatcgtcccctcctatctgctgaagccggtcagc
gtcgacgcctcgaactggaagcaggtcctggtcgatggcggctactacaaggaatcgcag
atcaagtga

DBGET integrated database retrieval system