KEGG   Azospirillum sp. B510: AZL_e03700Help
Entry
AZL_e03700        CDS       T01169                                 

Gene name
ilvD
Definition
(GenBank) dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
azl  Azospirillum sp. B510
Pathway
azl00290  Valine, leucine and isoleucine biosynthesis
azl00770  Pantothenate and CoA biosynthesis
azl01100  Metabolic pathways
azl01110  Biosynthesis of secondary metabolites
azl01130  Biosynthesis of antibiotics
azl01210  2-Oxocarboxylic acid metabolism
azl01230  Biosynthesis of amino acids
Module
azl_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
azl_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:azl00001]
 Metabolism
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    AZL_e03700 (ilvD)
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    AZL_e03700 (ilvD)
Enzymes [BR:azl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     AZL_e03700 (ilvD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ILVD_EDD
Motif
Other DBs
NCBI-ProteinID: BAI76715
RhizoBase: AZLe03700
UniProt: D3P7T6
Position
pAB510e:467814..469640
Genome map
AA seq 608 aa AA seqDB search
MSETKPPFPANSSDSGRRLRSRAWFDNPANPDMTALYLERYLNFGLTREELQSGAPIIGI
AQTGSDLSPCNRHHLVLAERLREGIRTAGGIAIEFPVHPIQETGKRPTASIDRNLAYLGL
VEVLHGYPLDGVVLTIGCDKTTPACLMAAATVNIPAIALSVGPMLNGWFRGERTGSGTIV
WKARQMMAAGEIDYQGFIELVASSAPSTGYCNTMGTASTMNSLAEVLGMQLPGSAAIPAP
YRERQQAAYETGKRIVEMVRQDIKPSDILTRDAFLNAIVVNSAIGGSTNAPIHINAIAKH
IGVPLTVDDWQTHGLDVPLLVNLQPAGEYLGEDFHRAGGVPAVVGQLMTKGLIRENAPNV
NGRTIGENCRDTEILDTRVIHPIDDPLKINAGFVVLRGNLFNAAIMKTSVISEEFRERYL
SNPKDPEAFEGKVVVFDGPEDYHHRIDDPSLGIDAYTILVIRGAGPIGYPGAAEVVNMRP
PADLIKQGVHSLPCIGDGRQSGTSGSPSILNASPEAAAGGNLGLLRSGDRVRIDLRRGSA
DILISEAELAERRAALEAAGGYAAPASQTPWQEIQRGIVDQLDEGMVLKPAVKYQRVAQT
MGIPRDNH
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagacgaagccccccttccccgccaattcctccgattcagggcgtcggctgcgc
tcgcgcgcgtggttcgacaaccccgccaaccccgacatgacggcgctgtatctggagcgt
tacctgaatttcggcctgacgcgggaagagcttcagtccggcgccccgatcatcggcatc
gcccagaccggatccgacctcagcccctgcaaccgccaccatctggtgctggccgaacgg
ctgcgcgagggcatccgcaccgccggcggcatcgccatcgaattcccggtccacccgatc
caggagaccggcaagcggccgaccgcctcgatcgaccgcaacctcgcctatctcggcctg
gtggaggttctgcatggctatccgctggacggcgtggtgctgaccatcggctgcgacaag
accaccccggcctgtctgatggcggcggcgaccgtcaacatcccggccatcgcgctctcg
gtcggcccgatgctgaacggctggttccgcggcgagcgcaccggctcgggcaccatcgtg
tggaaggcccgccagatgatggcggccggcgagatcgactatcagggcttcatcgagctg
gtggcctcttccgccccctcgaccggctactgcaacaccatgggcaccgcctcgaccatg
aattcgctggccgaggtgctgggcatgcagctccccggatccgccgcgattcccgccccc
taccgcgagcgccagcaggccgcctatgagaccggcaagcgcatcgtcgagatggtgcgc
caggacatcaagccgtcggacatcctgacccgcgacgccttcctgaacgccatcgtcgtc
aattcggccatcggcggctcgaccaacgcgccgatccacatcaacgccatcgccaagcac
atcggcgtgccgctgacggtggacgactggcagacccacgggctggacgttccgctgctg
gtcaatctccagccggcgggcgaatatctgggcgaggacttccaccgcgccggcggcgtg
ccggcggtggtcggccagctgatgaccaagggcctgatccgcgaaaatgcgcccaacgtc
aacggccgcaccatcggcgagaactgccgcgacaccgagatcctcgacacccgcgtcatc
catccgatcgacgacccgctgaagatcaacgccggcttcgtggtgctgcgcggcaacctg
ttcaacgccgccatcatgaagaccagcgtcatttccgaggagttccgcgagcgctacctg
tccaacccgaaggatccggaggcgttcgagggcaaggtcgtcgtcttcgacgggccggag
gattatcaccatcgcatcgacgatccctcgctgggcatcgacgcctacaccatcctggtc
atccgcggcgccggcccgatcggctatccaggcgctgcggaggtggtgaacatgcgtccg
cccgccgatctcatcaagcagggcgttcattccctgccctgcatcggcgacgggcgccag
tccggcacctcgggctcgccctcgatcctgaacgcctcgcccgaggcggcggcgggcggc
aatctcggcctgctgcgcagcggcgaccgggtgcgcatcgacctgcgccgcggcagcgcc
gacatcctgatctccgaagcggaactggctgaacgccgcgccgccctggaggccgccggc
ggctatgcggcaccggcgtcgcagacgccgtggcaggagatccagcgcggcatcgtcgac
cagctcgacgagggcatggttctgaagccggcggtcaagtaccagcgcgtcgcccagacc
atgggcattccgcgcgacaaccactga

DBGET integrated database retrieval system