KEGG   Azospirillum sp. B510: AZL_e03720Help
Entry
AZL_e03720        CDS       T01169                                 

Gene name
bztA
Definition
(GenBank) general L-amino acid transport system substrate-binding protein
Organism
azl  Azospirillum sp. B510
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3
Motif
Other DBs
NCBI-ProteinID: BAI76717
RhizoBase: AZLe03720
UniProt: D3P7T8
Position
pAB510e:473302..474363
Genome map
AA seq 353 aa AA seqDB search
MRMKPVAAAVGLLLALHPVPPADAAPPDTISARATDRPVLAEIERRGVVRCGVSFNPGFA
ANDDGGRPVGFMVDLCRALAAAVLGKADAIEIRRLSKPQEFDAVAAGEVDVSFAQTSWTL
TRDVTHAVDFGPPVFYDVQGIAAWRLPDGGSALDGGELTVCMPAGTTTQAEMESLIAGGK
RPWKLRSFPGWPDALEAFLSRDCAALGADRAQLTTALHMLGLPPDSLEITDAPLASREPL
APMTPNSDRNWMAAVRWTMFALFLADDAGVSGANANFQRITGGSEMRRLLSGIPEVAAKA
GLRPDWAYQAVVQVGNYGEIFDRNLGARSPFKLERGLNRPWTQGGLLYAPVFQ
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgcggatgaagcctgtcgccgccgcggtcggcctgctgctggctctgcatccggtgccg
cccgccgacgcggcgccgcccgacaccatctccgcccgcgccaccgaccggccggtcctg
gcggagatcgagcggcgcggggtggtgcgctgcggggtgtccttcaatcccggcttcgcc
gccaacgacgacggtgggcggccggtcggcttcatggtcgatctatgccgggcgctggcc
gccgccgtcctgggcaaggccgacgccatcgagatccgccggctgtcgaagccgcaggaa
ttcgatgccgtggccgccggcgaggtcgatgtctccttcgcccagacctcctggacactg
acgcgggacgtcacccatgccgtcgatttcgggccgccggtcttctacgacgtgcagggg
atcgccgcatggcggctgcccgacggcgggtcggcgctcgatggcggcgagttgacggtc
tgcatgccggccggcaccaccacccaggccgagatggaatcgctgatcgccgggggaaag
cgcccatggaagctccgcagcttccccggctggcccgacgcgctggaagccttcctcagc
cgcgattgcgccgcgctcggcgccgaccgcgcccaattgaccacggcgttgcacatgctg
ggcctgccgccggactcgctggagatcaccgacgcgccgctcgcttcgcgcgaaccgctg
gcaccgatgaccccgaacagcgaccgcaattggatggcggcggtgcgctggaccatgttc
gccctgttcctggccgatgatgccggggtttccggcgccaacgccaatttccagcgcatc
accggcggcagcgagatgcggcgcctgctgtccggcatcccggaggtggcggcgaaggcc
ggcctgcgcccggactgggcctatcaggcggtggtgcaggtcgggaattacggcgagatc
ttcgaccgcaacctcggcgcccgctcccccttcaagctggagcgcggcctgaaccggcct
tggacccagggcggactgctctacgccccggtgttccagtaa

DBGET integrated database retrieval system