KEGG   Azospirillum sp. B510: AZL_e03730Help
Entry
AZL_e03730        CDS       T01169                                 

Definition
(GenBank) major facilitator superfamily
Organism
azl  Azospirillum sp. B510
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sugar_tr MFS_1 DUF2484 DUF2721
Motif
Other DBs
NCBI-ProteinID: BAI76718
RhizoBase: AZLe03730
UniProt: D3P7T9
Position
pAB510e:474559..476283
Genome map
AA seq 574 aa AA seqDB search
MKTMAYAASTGDAVRPMTGEEKKVIFASSLGTVFEWYDFYLYGSLSAVIAAQFFSGVNPT
AGFIFALMAFAAGFAVRPFGALVFGRLGDMIGRKYTFLVTILIMGLSTFIVGILPNYASI
GIAAPIILIALRLLQGLALGGEYGGAATYVAEHAPHGRRGNYTSWIQTTATLGLFLSLLV
ILGCRVSVSPEDFNAWGWRIPFLISIALLGVSVWIRLMLNESPAFKKMKEEGKHSKAPLT
ESFGQWKNLKIVLLALFGLVAGQAVVWYTGQFYALFFLTQTLKVDAQAANLMIAAALLIG
TPFFVIFGSLADRIGRKPIIMAGLLLACLTYFPLFKGITHYANPALEEAIATAPVVVVAD
PNECSFQFNPVGTSQFTSSCDIAKSALVRRGIPYTNEAAPAGTVASITVGSTVIPSYSAV
PQAGTTVSLSHGPATAATPTDAKAAGAAFDKGLGDALKAANYPAKADPARIDAVMVIALL
TVLVIYVTMVYGPIAAMLVEMFPTRIRYTSMSLPYHIGNGWFGGFLPTTSFAIVAATGDI
YSGLWYPIVIAAATLVIGLLFVRETKDVDIYQHD
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaccatggcctatgcggcttcgacgggagacgccgtccgaccgatgacgggcgag
gagaagaaggtcatcttcgcttcgtcgctcggaacggtgttcgagtggtacgacttctat
ctctacggctcgctcagcgcggtcatcgccgcgcagttcttttccggcgtcaatccgacg
gcgggcttcatcttcgcgctgatggcgtttgccgccggcttcgcggtccggcccttcggc
gcgctggtcttcggccgcctcggcgacatgatcggccgcaaatacaccttcctggtcacc
atcctgatcatgggcctgtcgaccttcatcgtcggcatcctgcccaactacgcctccatc
ggcatcgccgccccgatcatcctgatcgccctgcgcctgctccagggcctggcgctgggc
ggcgaatatggcggtgccgccacctatgtcgccgaacatgccccgcatggccgccgcggc
aactacacctcctggatccagaccacggcgacgctcggcctgttcctgtcgctgctggtg
atcctgggctgccgggtgtcggtgtcgccggaggatttcaacgcctggggctggcgcatc
ccgttcctgatctccatcgccctgctcggcgtctcggtgtggatccggctgatgctgaac
gaatcgcccgccttcaagaagatgaaggaggagggcaagcattccaaggcgccgctgacc
gagtccttcggccagtggaagaacctgaagatcgtcctgctcgccctgttcggcctcgtc
gctggtcaggcggtggtctggtataccggccagttctatgccctgttcttcctgacccag
acgctgaaggtcgatgcccaggccgccaacctgatgatcgcggcggctttgctgatcggc
acgcccttcttcgtcatcttcggctcgctggccgaccggatcggccgcaagccgatcatc
atggccgggctgctgctggcctgcctgacctatttcccgctgttcaaggggatcacccac
tacgccaacccggcgctggaagaggccatcgccaccgccccggtcgtcgtggtcgccgat
ccgaacgagtgttcgttccagttcaacccggtcggcaccagccagttcaccagctcgtgc
gacatcgccaagagcgccctggtgcggcgcggcatcccctacaccaacgaggccgccccg
gccggcaccgtggcgtcgatcacggtcggcagcacggtcattcccagctattcggccgtg
ccgcaggccggcaccaccgtgtcactgagccatggcccggcgaccgccgccacaccgacc
gatgccaaggccgccggtgccgccttcgacaagggtctgggcgacgcgctgaaggccgcc
aactatccggccaaggccgatccggcccgcatcgacgcggtgatggtcatcgccctgctg
acggtgctggtcatctatgtgaccatggtctacggcccgatcgccgccatgctggtggag
atgttcccgacccgcatccgctacacctcgatgtcgctgccctaccatatcggcaacggc
tggttcggcggcttcctgccgaccacctccttcgccatcgtggcggccaccggcgacatc
tattccggcctctggtacccgatcgtcatcgccgccgcgacgctggtgatcggcctgctg
ttcgtccgcgaaaccaaggacgtggacatctaccagcacgattga

DBGET integrated database retrieval system