KEGG   Azospirillum sp. B510: AZL_e03740Help
Entry
AZL_e03740        CDS       T01169                                 

Definition
(GenBank) two-component hybrid sensor and regulator
Organism
azl  Azospirillum sp. B510
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAS_7 HATPase_c HisKA Response_reg PAS_8 PAS_4 HATPase_c_2 PAS
Motif
Other DBs
NCBI-ProteinID: BAI76719
RhizoBase: AZLe03740
UniProt: D3P7U0
Position
pAB510e:476406..479924
Genome map
AA seq 1172 aa AA seqDB search
MESWFILAASLAYLLSLFAIAWYGDRTGTQGGGKQGGDRRTPWLYALSFGVYCTSWTFYG
AVGRAATGGFYFLPIYIGPILMIGLGWPVLARIVRVAKSENVVSISDFLSARYGKSRGLA
ALVTIAAVIGLLPYIALQLKAISVSFEILAGASLGTDLSQMPGGTALMAALLMAAFAILF
GVRSVSANEHHRGLMMAIAAESVVKLAAALGVGGAIAVSVFGDPATFVDAAIRNPGFLEM
IRLDSIGTDWWVACLLSGLAILCLPRQFHVAVVENTHGGDVRSSAKLFPAYLVAINLFVL
PVALAGLMLFPDGTTNADTFMVSIPLSQGWPWLALAAFIGGLSAATSMILVEMVALSTMI
CNDIAVPLLMALRPDDRRLRDNPAGILLLVRRSAVIVLVLLSYGCYRLIGPAFPLATIGM
MSFTAVAQFAPALLGGLVWSRASRSGAFAGICAGFLGWAYTMLLPSFADAGWLASSALRE
GPFGLTGLSPVALAGIAGIDPLTNAALWSLGPNILLFVLVSLLTRPSTLERQQAARFISL
RRSTDGEPHGPRGATLADLHDLAMRYVGQPRADAAFRRFTGVADGDLRTALLMRTDGEAI
QLTERLLAGAVGSASARVVVAGLLSDRRLSRTDARSIIDEASRAILKQHELLRATVENVP
QGIAVFDEDWRVATWNNQFVVLLELPDGFVQVGTSLQDIVGLIARRGEYGRDGEIETLLE
RRSDPRRRNRPDVYERVRPDGTVLEIATNPMPGSTPGRGGFVAVYTDVTERHRAAAALRE
ANETLERRIAERTHALSEAKAEAERANRGKTRFLAAASHDLLQPLHAARLFLSALAERNG
DSAIRQIDASLRSVETILGDLLDVSKIDSGVVKPNPVPMRIEELLKPLGEEFTVLASRHG
LGLRVVDCSATVRSDPTLLRRILQNYLANAVRYTRTGRILLGCRRRGGMLSIEVWDTGPG
IPEHKVPEIFMEFRQLDHDGDDRGDRGKGLGLGLAIVERLAGILGHSVQVRSHVGRGSAF
SVLVPLTDEPVAARAVVVRPRGRDLSGVLVLCLENEPAIARATEDLLSSWSCRVVTAVAP
DLALAALGGRVPDVILSDYHLDRSLTGVEALRTLRGSLGSDIPAAVVTADRDPAVREDIE
AAGCRLLYKPVRPGALRALLGQLLAEGQRMAG
NT seq 3519 nt NT seq  +upstreamnt  +downstreamnt
atggaaagctggttcatcctggccgcgtcgctggcctatctgctgtccttgttcgccatc
gcctggtacggcgaccgcaccggcacgcaggggggcggcaagcagggcggcgaccggcgc
acgccctggctctacgcgctcagttttggcgtctattgcacctcctggaccttctatggc
gcggtcggccgggcggcgaccggcggcttctatttcctgccgatctatatcgggccgatc
ctgatgatcgggctgggctggccggtgctggcccgcatcgtccgcgtcgcgaaatccgag
aatgtcgtctcgatctccgacttcctgtccgcccgctacggcaagagccgcgggctggcc
gccctcgtcaccatcgccgcggtgatcgggctcctgccctacatcgccctgcaattgaag
gcgatcagcgtcagcttcgaaatcctggccggcgcctcgctcggcaccgatctcagccag
atgccgggcgggacggcgctgatggcggcattgctgatggcggccttcgccatcctgttc
ggcgtgcgcagcgtgtcggccaacgagcatcaccgcggcctgatgatggccatcgccgcc
gaatcggtggtgaagctggcggcggcgctcggggtcggcggcgccatcgccgtatccgtc
ttcggcgacccggcgaccttcgtcgatgccgccatccgcaatccgggcttcctggagatg
atccggctggacagcatcggcaccgactggtgggtcgcctgcctgctgtccgggctggcg
atcctctgcctgccgcgccagttccatgtcgcggtggtggagaacacccatggcggcgac
gtgcgctcgtcggcgaagctgttcccggcctatctggtcgccatcaacctgttcgtgctg
ccggtggcgctggccgggctgatgctgttccccgacggcaccaccaacgccgacaccttc
atggtctccatccccctgagccagggctggccatggctggcgctggccgccttcatcggc
gggctgtcggccgccaccagcatgatcctggtggagatggtggcgctcagcaccatgatc
tgcaacgacatcgccgtcccgctgctgatggcgctgcgccccgacgaccggcggctgcgc
gataatccggccggcatcctgctgctggtgcggcggtcggcggtgatcgtgctggtcctg
ctgtcctatggctgctatcggctgatcggtccggcctttccgctggcgaccatcggcatg
atgagcttcaccgcggtggcgcagttcgcccccgccctgctcggcggcctggtctggagc
cgggccagccgcagcggcgccttcgccggcatctgcgccggcttcctcggctgggcctac
accatgctgctgccctccttcgccgacgccggctggctggcctccagcgcgctgcgcgag
gggccgttcggcctgaccgggctcagtccggtggcgctggccggcatcgccggcatcgac
ccgctgaccaacgccgcgctgtggagcctggggccgaacatcctgctgttcgtcctggtg
tcgctgctgacccgcccctcgaccctggagcgccagcaagccgcccgcttcatcagcctg
cgccgttcgaccgacggcgagccgcacgggccgcgcggcgccacgctggccgatctgcac
gacctcgccatgcgctatgtcgggcagccgcgcgccgacgccgccttccgccgcttcacc
ggggttgccgacggcgacctgcgcaccgcgctcctgatgcgcaccgacggcgaggcgatc
cagctgaccgaacggctgctcgccggggccgtcggctcggcctcggcccgcgtggtggtg
gcggggctgctgtccgaccgccggctgtcgcgtaccgacgcccgctccatcatcgacgag
gcgtcgcgcgccatcctgaagcagcatgagctgctgcgcgccacggtggagaatgtgccg
cagggcatcgccgtgttcgacgaggattggcgcgtcgccacctggaacaaccagttcgtc
gtcctgctggaactgccggacggcttcgtccaggtcggcacctcgctccaggacatcgtc
gggctgatcgcccggcgcggcgaatatggccgcgacggcgagatcgagacgctgctggaa
cgccgctccgacccgcgccgccgcaaccggcccgacgtctatgagcgggtgcggcccgac
ggcacggtgctggagatcgccaccaacccgatgccgggatcgacgcccggacggggggga
ttcgtcgccgtctacaccgacgtcaccgaacgccaccgcgccgccgccgccctgcgcgag
gccaacgagacgctggaacgccgcatcgcggaacgcacccacgccctgtcggaggcgaag
gcggaggccgaacgcgccaaccgcggcaagacccgcttcctcgccgccgccagccatgac
ctgctccagccgctgcacgccgcacgcctgttcctgtccgccctggcggagcgcaacggc
gacagcgccatccgccagatcgacgcctcgctgcgctcggtcgagaccatcctgggcgat
ctgctcgacgtctccaagatcgacagcggcgtcgtcaagccgaacccggtgccgatgcgg
atcgaggagttgctgaagccgctgggcgaggaattcaccgtgctggccagccggcacggg
ctcgggctgcgggtggtcgattgctccgccaccgtgcgcagcgaccccaccctgctgcgg
cgcatcctgcaaaactacctcgccaacgccgtgcgctacacccgcaccggccgaatcctg
ctgggctgccgccgccggggcggcatgctgtccatcgaggtgtgggacaccggccccggc
atccccgaacacaaggtgccggaaatcttcatggagttccgccagctcgaccatgacggc
gacgaccgcggcgaccgcggcaaggggctgggcctcggcctcgccatcgtcgagcggctg
gccggcatcctcggccacagcgtccaggtgcgctcccacgtcgggcggggcagcgccttc
tccgtgctggtgccgctgaccgacgaaccggtcgccgcccgcgccgtggtggtccgcccg
cgcggccgtgacctgagcggcgtgctggtgctctgcctggagaacgagccggcgatcgcc
cgcgccaccgaggatctgctgtcgagctggtcctgccgcgtcgtcaccgccgtcgccccc
gacctcgccctggcggcgctgggcggacgcgtccccgacgtgatcctgagcgactaccat
ctcgaccgcagcctgaccggggtggaggcgctgcggaccctgcgcggctccctgggcagc
gacatccccgccgccgtcgtcaccgccgaccgcgacccggccgtgcgcgaggacatcgag
gcggcgggctgccgcctgctctacaagccggtgcgtccgggcgcgctacgggcattgctg
gggcagctgctcgcggaagggcagcggatggcggggtaa

DBGET integrated database retrieval system