KEGG   Azospirillum sp. B510: AZL_e03800Help
Entry
AZL_e03800        CDS       T01169                                 

Definition
(GenBank) two-component hybrid sensor and regulator
Organism
azl  Azospirillum sp. B510
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg HATPase_c PAS_3 PAS_7 HisKA PAS GAF PAS_4 GAF_2 PAS_9 Hpt PAS_8 TruD SKA2
Motif
Other DBs
NCBI-ProteinID: BAI76725
RhizoBase: AZLe03800
UniProt: D3P7U6
Position
pAB510e:complement(485568..489500)
Genome map
AA seq 1310 aa AA seqDB search
MACRRKRGRGDRRVTGRSAGDSVERGAGLEPSGAVPAPLPPDENLRQVALDSYCVLDTPP
EPGFDNITRLARHFFGTRIALVSLIDRDRQWFKSRAGLDATETHRDLAFCAHAILDDGVL
VVLDATKDPRFAGNPLVTGAPNIRFYAGAPLVADGRKLGTLCVIDDAPRAGFDEREAETL
TQLARLVVDELTLRREVALRERAEAELRDRSRLLNLAEEVGQFGHWYIDFVTDTRRWSDE
VYRILGLPPQQEPPTVELSRASYHPDDLPLLARMAERARRTGEGFSVEARVVRRDGGMRH
VFVRASVECGADGRPAGLLGVVQDITDAKREEAELRSNRELLDLTVQATRDGIWDWNLET
GGIWFSPTWKEQLGYRDDELENSLEMWAGLIFEEDRFTALETVRAYNAGLIPNFEAVQRF
RHKRGHTVYILSRAIHIRDAAGRVVRMVGAHTDITREKLTEEELRLAKQTLDDAIEAVPE
GLAYFDADDRLILCNERYREAHPLTAPLFTPGRPFEEILRAAVANGEFAGNPDGPSDEAW
IQAELAQHRNPGAPFERELPDGRWIVVAENRTSSGSLVCTRTDITERKRFEAELQRQAAD
MCALAEGLDAAREEADALRARAEAATQAKSEFLAAMSHEIRTPMNGIMGMTELLFDTPLT
EEQRQFAQAIRSSSNALLTIINDILDISKLEAGRVTIETLPFDPADLVEGVVELLTPRAH
EKGIEIGFYIDPPLRRTLLGDPTRIRQILVNLVGNAVKFTDQGSVAVELEAREATDAHLV
LRMTVTDTGIGIPAEAMPTLFNKFQQVDGSITRKFGGTGLGLAICRQLSELMGGSIAVES
RLGSGSRFLVDLPLALPDEVRDDELSDGMQPPAERVLAEGALAEGALVGRRVLVADDLAV
NRRVLASMLDSLGARPAVVENGVDALAALRRAAAGGRPFDVLLADQTMPGLSGDALLAAV
AGDPALAQTRRVLMVTLGPAARGDGGPVQGVAQAILNRPLRQRALAGCLTGLFAATAPTA
AAPVVEVRPEEMPRSGRVLLAEDNRTNQLFATTLLRKLGYSVEVAEDGERAVAAVRRGGI
DLVLMDVQMPGMDGLEAAQAIRSCGGALAGLPIIALTADAMPGTRELCLRAGMSDYLTKP
ISRAGLLSALDRWMGAAGRPSEPSAIPSAGTVPGVDGKVGGMVEETGEAALDQAVLDDLA
QTVGADSLARIVGSFLDDLSGRLGRLSAMAEGRGAGIADLRALASEAHDLSSLAGSFGGM
AVMHHAWRMEVLCRNGDRDQAARLLPVLLRESARLERLLRARAGEHPMVG
NT seq 3933 nt NT seq  +upstreamnt  +downstreamnt
atggcgtgtcgccgaaaacgcggccggggagaccgccgcgtgaccgggcgttcggctggg
gattcggtggagaggggtgccggactggaaccgtcgggcgcggtgccggcgccgctgccg
ccggacgagaacctgcggcaggtggcgctcgactcctattgcgtcctcgacacgccgccg
gagcccggtttcgacaacatcacccggctggcccggcatttcttcggcacgcgcatcgcg
ctcgtctcgctgatcgaccgcgaccgccaatggttcaagagccgcgccgggctggacgcg
acggagacgcaccgcgacctcgccttctgcgcccacgccatcctggatgacggcgttctc
gtcgtcctcgatgcgacgaaggatccgcgcttcgccggcaatccgctggtcaccggggcg
cccaacatccgcttctatgccggcgcacccctggtggcggacgggcggaagctggggacg
ctgtgcgtcatcgacgacgcgccgcgggccggtttcgacgagcgcgaggcggaaacgctg
acacagctcgcccggctggtggtggacgagctgaccctgcgccgcgaggtggcgctgcgt
gagcgggcggaagccgaattgcgcgaccgttcgcgcctgctgaatctcgccgaggaggtc
ggccagttcgggcactggtacatcgatttcgttaccgacacccggcgctggtcggacgag
gtctaccgcatcctcggcctgccgccgcaacaggagccgccgacggtcgagctgtcgcgc
gcctcctaccatccggacgatcttccgcttctggccagaatggccgagcgggcgcggcgg
accggcgaggggttttcggtcgaggcgcgcgtcgtccggcgggacggcggcatgcgtcat
gtcttcgtgcgcgcctccgtcgaatgcggagccgacgggcggcccgccggcctgctcggc
gtcgtccaggacatcaccgacgccaagcgcgaggaggcggagctgcggtcgaaccgcgag
cttctcgacctgaccgtgcaggcgacgcgcgacggcatctgggactggaatctggagacc
ggcgggatctggttctcccccacctggaaggagcagctcggctaccgcgacgatgagctg
gagaacagcctggagatgtgggccggcctgatcttcgaggaggaccggttcacggcgctg
gagacggtccgcgcctacaatgccgggctgatcccgaatttcgaggcggtgcagcgtttc
cgccacaagcggggccacaccgtctacatcctcagccgcgccatccacatccgtgacgcc
gccggccgggtcgtgcggatggtcggcgcccataccgacatcacgcgcgagaagctgacg
gaggaggagctgcggctcgccaagcagacgctggatgacgcgatcgaggcggtgccggaa
gggctggcctatttcgacgccgacgaccggctgatcctgtgcaacgagcgctaccgcgag
gcccatccgctgacggcgccgctgttcacccccggccgtccgttcgaggagatcctgcgc
gccgccgtcgccaacggcgaattcgccggcaacccggacggtccgagtgacgaggcctgg
atccaggccgaactggcccagcaccgcaatcccggcgcgccgttcgagcgcgagctgccg
gacggccgctggatcgtggtggcggagaaccggaccagcagcggctcgctggtctgcacc
cgcaccgacatcaccgaacgcaagcgcttcgaggcggagcttcagcgtcaggccgccgac
atgtgcgcgctggccgaggggctggacgccgcccgcgaggaggccgacgcgctccgcgcc
cgcgccgaggcggcgacccaggcgaaatcggaattcctggcggcgatgagccacgaaatc
cgcacgccgatgaacggcatcatgggcatgacggagctgctgttcgatacccccctgacg
gaagagcagcgccagttcgcccaggcgatccgcagctcgtccaacgcgctgctgaccatc
atcaacgacatcctcgacatctccaagctggaggccggccgcgtcaccatcgagacgctg
cccttcgaccccgccgatctggtcgagggtgtggtggaactgctgaccccgcgcgcgcac
gagaaggggatcgagatcggcttctacatcgatccgccgctgcgccgcacgctgctgggt
gatccgacgcgcatccggcagatcctggtcaatctggtcggcaacgcggtgaaattcacc
gatcagggctccgtcgcggtggagctggaggcgcgggaggcgaccgacgcccatctggtg
ctgcgcatgacggtgaccgacaccggcatcggcatcccggccgaggcgatgccgaccctg
ttcaacaagttccagcaggtggacgggtcgatcacccgcaaattcggcggcaccggcctg
gggctggcgatctgccgccagctgtcggaactgatgggtggaagcatcgcggtggaaagc
cggctgggcagcggcagccgcttcctggtcgatctgccgctggccctgccggacgaggtg
cgggacgacgagctgtcggacggcatgcagccgccggccgaacgggtgctggccgaaggg
gcgctggccgaaggggcgctggtcgggcgccgcgtgctggtggcggatgatctggcggtg
aaccgcagggtgctggcctcgatgctcgacagtctgggcgcccggccggccgtggtcgaa
aatggggtcgacgcgctggcggccctgcggcgcgcggcggccggcggccggcccttcgac
gtgctgctggctgatcagaccatgcccggcctgagcggcgacgcgctgctggcggcggtc
gccggcgacccggcgctggcgcagacgcggcgcgttctgatggtgacgctgggtccggcg
gcgcggggcgatggcggacccgtccagggggtggcccaggcgatcctgaaccgtccgctg
cgccagcgggcgctggccggctgcctgaccggactgttcgccgccaccgctcccacggcc
gcggcaccggtggtggaggtccggccggaggagatgccgcgcagcggccgcgtcctgctg
gcggaagacaaccgcaccaaccagctgttcgccaccaccctgctgcgcaagcttggctac
agcgtcgaggtggcggaggacggggagcgggcggtggcggcggtccgccgcggcggcatc
gatctggtgctgatggatgtgcagatgccggggatggatgggttggaggcggcgcaggcg
atccggtcttgcggcggcgccctggccggcctgccgatcatcgcgctcaccgccgatgcc
atgcccggcacccgtgagctgtgtctgcgcgccggcatgagcgactatctgaccaagccg
atcagccgcgccggcctgctgtcggccctcgaccgctggatgggggcggcgggccgtccg
tccgaaccctcggccatcccctccgccggtaccgtccccggtgtcgacgggaaggtgggc
gggatggtggaggagacgggggaggcggcgctggaccaggcggtgctggacgatctggcc
cagacggtgggtgccgacagcctggcgcggatcgtcggcagcttcctcgacgacctgtcc
ggccggctggggcggctgtcggcgatggcggaggggcgcggggccggcatcgccgatctg
cgggcgctggcgtcggaggcgcatgacctgtccagtctcgccggcagcttcggcgggatg
gcggtgatgcaccacgcgtggcggatggaggttctctgccgcaacggcgaccgcgatcag
gcggcacggctgctgccggtcctgctgcgcgaatcagcccggctggaaagacttctgcgc
gcgcgtgccggcgagcatccgatggtggggtga

DBGET integrated database retrieval system