KEGG   Azospirillum sp. B510: AZL_e03820Help
Entry
AZL_e03820        CDS       T01169                                 

Gene name
pdhR
Definition
(GenBank) transcriptional regulator
  KO
K05799  GntR family transcriptional regulator, transcriptional repressor for pyruvate dehydrogenase complex
Organism
azl  Azospirillum sp. B510
Brite
KEGG Orthology (KO) [BR:azl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:azl03000]
    AZL_e03820 (pdhR)
Transcription factors [BR:azl03000]
 Prokaryotic Type
  Helix-turn-helix
   GntR family
    AZL_e03820 (pdhR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FCD GntR MarR_2 Rrf2 HTH_11 HTH_24 HTH_20 HTH_Crp_2 MarR PaaX HTH_29 Fe_dep_repress HTH_27 HTH_28 TrmB
Motif
Other DBs
NCBI-ProteinID: BAI76727
RhizoBase: AZLe03820
UniProt: D3P7U8
Position
pAB510e:complement(491015..491785)
Genome map
AA seq 256 aa AA seqDB search
MQGTIKPAKLADAIAEHLERLILEGALRPGEKLLAERELAVKLDVSRPSLRDAIAKLEER
GLLVSGRGGTHVATFLSQITDPLMTLMRNKPDASFDYLEFRRSIEVAAAGLAAQRATDVD
RDGIRAIVARMQAAHGKDDSSEEADSDADLHLAIYEAAHNVVMLHIMRTLSDLLRNDVFY
NRADLYSRPGVRELLLQQHLAIANAVLAGDAAAASAAAEAHVEFTLQTLREIREHNARVQ
VSLRRIGRTDLIDSGA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcaggggacgatcaaaccggccaagctggccgacgccattgccgagcatttggaaagg
ctgatcctggaaggcgcgctgcgtccgggcgagaagctgctggccgagcgcgaactggcg
gtgaagctggacgtgtcgcgcccgtccctacgcgacgccatcgccaagctggaggagcgc
ggcctgctggtcagcggccgtggcggcacccatgtggcgaccttcctgtcgcagatcacc
gatccgctgatgacgctgatgcgcaacaagccggacgcgtccttcgactatctggaattc
cgccgctccatcgaggtggcggcggccgggctggcggcgcagcgggcgaccgacgtcgac
cgcgacggcatccgcgccatcgtcgcccgcatgcaggccgcccacggcaaggacgacagc
tcggaggaggcggattccgacgccgacctgcatctggcgatctacgaggcggcgcacaat
gtcgtgatgctgcacatcatgcggacgctgtccgacctgttgcgcaacgacgtgttctac
aaccgtgccgacctctattcccggccgggggtgcgcgagctgctgttgcagcagcatctg
gccatcgccaacgcggtgctggccggcgacgcggcggcggcgagcgccgcggccgaggcc
catgtcgagttcacgttgcagaccctgcgcgagatccgcgagcacaatgcgcgggtccag
gtgtcgctacggcggataggacggaccgacctgatcgacagcggggcgtga

DBGET integrated database retrieval system