KEGG   Azospirillum sp. B510: AZL_e03870Help
Entry
AZL_e03870        CDS       T01169                                 

Definition
(GenBank) hypothetical protein
  KO
K00782  L-lactate dehydrogenase complex protein LldG
Organism
azl  Azospirillum sp. B510
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LUD_dom
Motif
Other DBs
NCBI-ProteinID: BAI76732
RhizoBase: AZLe03870
UniProt: D3P7V3
Position
pAB510e:499091..499762
Genome map
AA seq 223 aa AA seqDB search
MSDARNSILAKLRATRDAHPLTPPASDFTPIEAKVWPEEERLPRIRRLMEAVHTEFLDAT
EADWPAVLRGFLAREGVGSLLYAPATEAGKRLVEGWEKGPLPAPTLIPYDRPLEDLKPRL
FNAIDAGLTTTRGAIAETGSLILWPTAEEPRSLSLIPHIHVALLRADMLHDTFLQAVRAQ
GWAQAMPTNVLLVSGPSKTADIEQTLAYGVHGPKRLIVLVIHP
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacgcccgcaactccatcctggcgaagctgcgcgccacccgcgacgcccacccg
ctgaccccgcccgcctcggacttcacgccgatcgaggcgaaagtctggccggaagaggag
cgcctgccccgcatccgccgcctgatggaggcggtgcacaccgagttcctcgacgccacc
gaggccgactggccggcggtgctgcgcgggttcctggcgcgcgagggggtgggctcgctg
ctctacgccccggcgacggaggcgggcaaacggctggtcgaggggtgggagaaaggccct
ctcccggcccccaccctcatcccctacgaccgcccgctcgaagacctgaagccccggctg
ttcaacgccatcgacgccggcctgaccaccacgcgcggcgccatcgccgagaccggcagc
ctgatcctgtggccgacggcggaagagccgcgctccttgtcgctgatcccgcacatccat
gtggcgttgctgcgcgccgacatgctgcacgacaccttcctgcaagcggtgcgcgcgcag
ggatgggcgcaggcgatgccgaccaacgtgctgctggtgtccggcccgagcaagaccgcc
gacatcgagcagaccctggcctacggcgtccacggcccgaagcggctgatcgtcctggtg
atccatccatga

DBGET integrated database retrieval system