KEGG   Azospirillum sp. B510: AZL_e03970Help
Entry
AZL_e03970        CDS       T01169                                 

Definition
(GenBank) transcriptional regulator
  KO
K12266  anaerobic nitric oxide reductase transcription regulator
Organism
azl  Azospirillum sp. B510
Brite
Transcription factors [BR:azl03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    AZL_e03970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma54_activat Sigma54_activ_2 HTH_8 AAA_5 Mg_chelatase AAA GAF AAA_16 AAA_22
Motif
Other DBs
NCBI-ProteinID: BAI76742
RhizoBase: AZLe03970
UniProt: D3P7W3
Position
pAB510e:complement(510060..511676)
Genome map
AA seq 538 aa AA seqDB search
MDNDAVIPTTPLPPALSLEEAGALLLALDEPARLWPLLLDLMARHLPCDACALLRLDRGS
GNGPLVPLATRGLSPDTLGRRFGLEDHPRLKAIAGAGGGPLRFPAGCELPDPYDGLIPDL
DQRLHVHDCVGASLSVDGRPWGMLTLDALNEGRFDGWEEAIAAWAHFAADLAAAVERRVV
AAGEGGVGLRLPDDAPSGGDFAPVGSSPAMAGLLAEIDTVAASDLVVLVLGETGVGKELV
ARRLHARSRRAGGPLVHVNCAALPDALVESELFGHVRGAFSGALADRRGKFELADGGTLF
LDEVGELPAAAQAKMLRALQNGEIQRVGSDRHITVDVRVIAATNRDLAAEVREGRFRADV
YHRLSVYPLRVPPLRDRGTDILRLAGLFLERNRARLGLRNLRLSPAAERRMLAYPWPGNV
RELEHAIGRGAIRARVARPPDGGVLTLTPADLGLADAEEGEAGAPSSAMPAPRPRAPEVG
EVAELPDLPLREAVEALERRMVSAHLARHGGNWARAARSLGLDRSNLFRLARRLGLRE
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggacaacgatgcggtcattccgacaacgccgctcccaccggccctttcgctggaggag
gccggggcgctgctgctggcattggacgagccggcgcggctgtggccgctgctgctcgac
ctgatggcccggcatctgccctgcgacgcctgcgcgctgctgcgccttgaccggggttcc
gggaatgggccgctggttccgctcgccacgcgtgggctcagccccgacacgctcggccgg
cgctttgggctggaggatcatccccgcttgaaggcgatcgccggggcgggcggcgggccg
ctgcgttttcccgccggctgcgagctgcccgacccctatgacgggctgatccccgacctc
gaccagcgtctgcatgtccatgactgtgtcggggcgtccctgagcgtcgatggacgcccc
tggggcatgctgacgctggacgcgctgaacgagggacgctttgacggctgggaggaggcg
atcgccgcctgggcgcatttcgccgccgatctcgccgccgcggtggagcggcgggtggtc
gcggcgggggagggaggtgtgggcctgcggctccccgacgatgcgccgtcgggaggcgac
ttcgcccccgtcggctccagcccggcgatggcgggcctgctggcggagatcgacacggtg
gcggccagcgacctcgtcgtcctggtgctgggcgagaccggggtgggcaaggagctggtg
gcgcggcggctgcacgcccgttcccgccgggccggcggaccgctggtccacgtcaactgc
gccgccctgccggacgcgctggtggaaagcgagctgttcggccatgtgcgcggcgccttc
tccggggcgctggccgaccggcgcggcaagttcgagctggccgacggcggcaccctgttc
ctggacgaggtcggcgagctgccggcggcggcgcaggcgaagatgctgcgggcgttgcag
aatggcgagatccagcgcgtcggctccgaccggcacatcaccgtcgatgtgcgggtgatc
gccgccaccaaccgcgacttggcggcggaggtgcgtgaggggcgcttccgcgccgacgtc
tatcaccggctcagcgtctatccgctgcgggtgccgccgttgcgcgaccgcggcaccgac
atcctgcggctggccgggctgttcctggagcgcaacagggcgcggctgggcctgcgcaac
ctgcgcctgtcgccggcggcggaacggcggatgctggcctatccctggcccggcaacgtg
cgcgagctggagcatgccatcggccgcggcgccatccgcgcccgcgtcgcccggccgccc
gacggcggcgtgctgaccctgaccccggccgatctggggctggccgatgcggaggagggg
gaagccggcgccccgtcgtcggcgatgccggccccccggccccgcgcgccggaggtcggg
gaggtggcggagctgccagacttgccgctgcgcgaggcggtggaggcgctcgagcgccgg
atggtcagcgcccatctggcccgccatggcggcaactgggcgcgggcggcgcggtcgctc
gggctcgaccgcagcaacctgttccgcctcgcccggcggctggggttgcgggaatga

DBGET integrated database retrieval system