KEGG   Azospirillum sp. B510: AZL_e03980Help
Entry
AZL_e03980        CDS       T01169                                 

Gene name
hmp
Definition
(GenBank) nitric oxide dioxygenase
  KO
K05916  nitric oxide dioxygenase [EC:1.14.12.17]
Organism
azl  Azospirillum sp. B510
Brite
Enzymes [BR:azl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.17  nitric oxide dioxygenase
     AZL_e03980 (hmp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_6 Globin NAD_binding_1 Protoglobin
Motif
Other DBs
NCBI-ProteinID: BAI76743
RhizoBase: AZLe03980
UniProt: D3P7W4
Position
pAB510e:511810..512985
Genome map
AA seq 391 aa AA seqDB search
MLTPAQIAVIKATAPVVAANATRITGTFYPLMFERFPEVRAVFNQSHQRNSAQPEALANA
IIAYATNIDRLEVLGPAVEGIVQKHVSLNITPDQYKIVGTCLMEAIGTVLGDAVTAEIAD
AWGAAYWQLAELLIAAEEKEYARKAALTGGWRGARRFRIVGKTPESAVITSFRLAPADGG
RVMDFQPGQYLGLRLTIDGETVHRNYSLSASPNGHDYRISVKREPHGLVSGFLHDRAQLG
DEIDVYPPAGEFVLRQGSGPLLLITGGVGQTPALPLAEQALAAGREVIYVHAALNGSVHA
FRRQIDELAARHDTLKPVYCYAEPQPGDTPHMVGLLDQERLAGLLPRDPGVAAYIVGPKP
FMAAVVKALSALGLPDKAIVHEFFGPREALA
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgctgacccccgcccagatcgccgtcatcaaggccaccgccccggtggtggccgccaac
gccaccaggatcaccggcaccttctatccgctgatgttcgagcgcttccccgaggtgcgc
gccgtcttcaaccagagccaccagcgcaacagcgcccagccggaggcgctggccaacgcc
atcatcgcctatgccaccaacatcgaccggctggaggtgctggggccggcggtggagggg
atcgtgcagaagcacgtctcgctcaacatcacccccgaccagtacaagatcgtcggcacc
tgcctgatggaggcgatcggcacggtgctgggcgacgcggtgacggccgagatcgccgac
gcctggggggcggcctattggcagctcgccgagctgctgatcgcggcggaggaaaaggaa
tatgcccgcaaggcggcgctgaccggcggctggcgcggcgcgcggcgcttccgcatcgtc
gggaagacgccggaaagcgccgtcatcacctcgttccggctggcgccggccgatggcggg
cgggtgatggacttccagcccggccaatatctcggcttgcgcctgaccatcgatggcgag
accgttcaccgcaactacagcctgtcggcctcgcccaacggccatgactaccgcatctcg
gtgaagcgcgagccccatgggctggtttccggcttcctgcacgaccgtgcccagcttggc
gacgagatcgacgtctacccgccggccggcgagttcgtgctgcgccaggggagcggcccg
ctgctgctgatcaccggcggcgtcggccagaccccggcgctgccgctggccgagcaggcg
ctggccgccggacgcgaggtcatctatgtccatgccgccctcaacggctcggtccacgcc
ttccgccggcagatcgacgagttggccgcccggcacgacaccttgaagccggtctactgc
tatgccgagccgcagccgggcgacacgccgcacatggtcgggctgctcgaccaggagcgg
ctggccgggttgctgccgcgggaccccggcgtcgccgcctacatcgtcggtccgaagccc
ttcatggccgccgtcgtcaaggcgctgtccgcgctcggcctgccggacaaggccatcgtc
cacgagttcttcggcccgcgcgaggcactcgcctga

DBGET integrated database retrieval system