KEGG   Azospirillum sp. B510: AZL_e04010Help
Entry
AZL_e04010        CDS       T01169                                 

Definition
(GenBank) transcriptional regulator
  KO
K19337  RpiR family transcriptional regulator, carbohydrate utilization regulator
Organism
azl  Azospirillum sp. B510
Brite
Transcription factors [BR:azl03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    AZL_e04010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_6 SIS SIS_2 DUF2529 ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: BAI76746
RhizoBase: AZLe04010
UniProt: D3P7W7
Position
pAB510e:516825..517769
Genome map
AA seq 314 aa AA seqDB search
MLDTIVSSLDSLRRAEAAVARSVLADPEAAVRDSLAQLAGKAGVSEPSVLRFCRSTGFGG
FQEFKIALAQHLAAAAAREEAGERPTPLVRDLAPGDSVASAAEKVLNRSIDALVRLRGRL
DTNALERAAAALARAGRVQIVGVGASGTVALDAHHKLFRLLPQVSASTDAHLQAMAAATL
GPGDALLAISKTGTSDEIFDVAAIARDGGATVIAITASATPLAERADIRLTVDVDEDTAV
HTPMASRLAQLALVDALTVAVGLQAPPGLDRRLARIKAVLAGHHRVPERPVAVSPLPRKT
SLRENSQRQTSEES
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgctggacacgatcgtctcctccctcgacagcctccgccgcgcggaagcggcggtggcg
cgctcggtgctggccgatccggaggccgcggtgcgcgacagcctggcccagctggccggc
aaggcgggggtcagcgagccgtcggtgctgcgcttctgccgttcgaccggcttcggcggc
ttccaggaattcaagatcgcgctggcccagcatctggcggccgccgccgcgcgggaggag
gccggcgagcgcccgaccccgctggtgcgcgacctcgcccccggcgacagcgtcgccagc
gcggcggaaaaggtgctgaaccgctcgatcgacgcgctggtgcgcctgcgcggccggctc
gacaccaacgccctggagcgcgccgccgccgcgctggcgcgggccgggcgggtgcagatc
gtcggtgtcggcgcctcgggcacggtggcgctggacgcccaccacaagctgttccgcctg
ttgccgcaggtcagcgccagcaccgacgcccatctccaggcgatggcggcggcgacgctc
ggcccaggcgacgccctgctggcgatctccaagaccgggaccagcgacgagatcttcgac
gtcgccgccatcgcccgcgacggcggggcgacggtgatcgccatcaccgcgtcggcgacc
ccgctggccgaacgcgccgacatccgcctgaccgtcgatgtcgacgaggacaccgccgtc
cacaccccgatggcctcgcgcctggcccagctcgcgctggtcgacgcgctgaccgtcgcc
gtcggattgcaggcgccgcccggcctcgaccgccgtctcgcccgcatcaaggcggtgctg
gccgggcaccaccgcgtgcccgagcggcccgtcgccgtttcccccctcccccgcaagacc
tccctccgggaaaattcccaaaggcaaacctccgaggaatcctga

DBGET integrated database retrieval system