KEGG   Azospirillum sp. B510: AZL_e04020Help
Entry
AZL_e04020        CDS       T01169                                 

Gene name
eda
Definition
(GenBank) 2-dehydro-3-deoxyphosphogluconate aldolase
  KO
K01625  2-dehydro-3-deoxyphosphogluconate aldolase / (4S)-4-hydroxy-2-oxoglutarate aldolase [EC:4.1.2.14 4.1.3.42]
Organism
azl  Azospirillum sp. B510
Pathway
azl00030  Pentose phosphate pathway
azl00630  Glyoxylate and dicarboxylate metabolism
azl01100  Metabolic pathways
azl01120  Microbial metabolism in diverse environments
azl01200  Carbon metabolism
Module
azl_M00061  D-Glucuronate degradation, D-glucuronate => pyruvate + D-glyceraldehyde 3P
azl_M00631  D-Galacturonate degradation (bacteria), D-galacturonate => pyruvate + D-glyceraldehyde 3P
Brite
KEGG Orthology (KO) [BR:azl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AZL_e04020 (eda)
   00630 Glyoxylate and dicarboxylate metabolism
    AZL_e04020 (eda)
Enzymes [BR:azl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.14  2-dehydro-3-deoxy-phosphogluconate aldolase
     AZL_e04020 (eda)
   4.1.3  Oxo-acid-lyases
    4.1.3.42  (4S)-4-hydroxy-2-oxoglutarate aldolase
     AZL_e04020 (eda)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase PilJ
Motif
Other DBs
NCBI-ProteinID: BAI76747
RhizoBase: AZLe04020
UniProt: D3P7W8
Position
pAB510e:517769..518422
Genome map
AA seq 217 aa AA seqDB search
MSATQTPAEILDQLVAYGVVPVIRNSSADLARTAVTWLREAGYGTFEITMTTPGAVGLIE
ELSAAGGALIGAGTVLTPAAVADVVKAGARYVVSPCVVPKVAAACRDHGVACLMGALTPT
EVHAAISAGADAIKIFPASTVGPAHIKALKSVFPGVRFVPTGGIDATTVASYVAAGVACV
GAGGKLVDEGLVKKGDREAILAAGRQLMDAYRAAKAA
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccacccagacccccgccgaaatcctcgaccagctcgtcgcctatggcgtcgtc
ccggtcatccgcaacagctccgccgatctggcccgcaccgccgtgacctggctgcgcgaa
gccggctacggcaccttcgagatcaccatgaccacccccggcgccgtcggcctgatcgag
gagctgtcggcggcgggtggcgccctgatcggcgccggcacggtcctgacccccgccgcc
gtcgccgacgtggtgaaggccggcgcccgttacgtcgtgtcgccctgcgtcgtgccgaag
gtggccgccgcctgccgcgaccatggcgtcgcctgcctgatgggcgccctgacccccacc
gaggtgcatgccgccatctccgccggcgccgacgccatcaagatcttcccggcctccacc
gtcggcccggcccacatcaaggcgctgaagtcggtcttccccggcgtgcgcttcgtcccc
accggcggcatcgacgccaccaccgtcgcctcctatgtcgcggccggggtggcctgcgtc
ggcgccggcggcaagctggtcgacgaggggctggtcaagaagggcgaccgcgaggccatc
ctcgccgccggacgccagctgatggacgcctaccgcgccgccaaggcggcctga

DBGET integrated database retrieval system