KEGG   Azospirillum sp. B510: AZL_e04040Help
Entry
AZL_e04040        CDS       T01169                                 

Gene name
cstA
Definition
(GenBank) carbon starvation protein
  KO
K06200  carbon starvation protein
Organism
azl  Azospirillum sp. B510
Brite
KEGG Orthology (KO) [BR:azl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    AZL_e04040 (cstA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CstA CstA_5TM
Motif
Other DBs
NCBI-ProteinID: BAI76749
RhizoBase: AZLe04040
UniProt: D3P7X0
Position
pAB510e:complement(520371..522176)
Genome map
AA seq 601 aa AA seqDB search
MDHALTFVIATLCILALCYRFYGVFFVRKVLRADDSEVTPSHLLEDGKNYVPTKKWVNAG
QHFAAIAAAGPLVGPVLAAQFGYLPSFLWLLIGCVIGGAVHDTVVLFASMKHKGQSLSEV
AKVELGPVAGWCTGLAMLFIITITMAGLSMVVVHALERNAWGTFAVFMTIPIAIALGLYE
RVTGSSKGATQVGIAAIAASVFAGPYIQGTMLGDWLTLHAETVAVALPVYAFFATALPVW
MLLTPRGYLSSFMKIGVFGALVVGVVFINPEIRFPALTDFIHGGGPVLNGPVWPFISITI
ACGAISGFHAFIGSGTTPKLIDKWSDIRPVAFGGMLAECLVGVMALIAATSLHPADYFAI
NSAPAAFKALGMDVVDLPRLSQDIGLDLYGRTGGAVTLAVGMTEIFTRVPWFNSLASYFF
QFVVMFEAVFILTAVDSGTRVARYLIQDLLGDLYAPMKRLDWVPGSIIASVIACVAWGYL
LTSGDINSVWALFGVSNQLMASVGLIIGATIILRLAQKRVYMLTCLIPLAYLFVTVNAAG
YWMIANVYLNTASKGYNPFNAGISIIMLALGFVILIAALRKWKDLLQTRAIEVPMVATPA
E
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atggatcacgccctaacctttgtgatcgcgacactctgcattcttgcgctctgctaccgc
ttctatggcgtgttcttcgtgcgcaaggttctccgtgccgacgattcggaagtcaccccg
tcccacctgctggaggacggcaagaattatgtacccaccaagaaatgggtgaatgccggc
cagcatttcgccgccatcgccgccgccggcccgctggtcggcccggtgctggccgcccag
ttcggctatctgccgagtttcctgtggctgctgatcggctgcgtcatcggcggtgcggtg
catgacaccgtcgtgctgttcgcctcgatgaagcacaagggacagtcgctgtccgaggtc
gccaaggtcgaactcggcccggtggccggctggtgcaccggtctggcgatgctgttcatc
atcaccatcaccatggccggcctgtcgatggtcgtcgtccatgccctggaacgcaacgcc
tggggcaccttcgcggtgttcatgacgatccccatcgccatcgcgctcggcctttatgag
cgtgtcaccggctcgtccaagggcgccacccaggtcggcatcgccgccatcgccgcctcg
gtcttcgccggcccctacatccagggcacgatgctgggcgactggctgacgctgcatgcc
gaaaccgtggccgtcgccctgccggtctacgccttcttcgccacggcgctgccggtgtgg
atgctgctgaccccgcgcggctatctgtcgagcttcatgaagatcggcgtgtttggggcg
ctggtcgtcggcgtcgtcttcatcaaccccgagatccgctttcccgccctgaccgacttc
atccatggcggcggcccggtgctgaacggcccggtctggcccttcatctcgatcaccatc
gcctgtggcgccatctccggcttccatgccttcatcggctcgggcaccacgcccaagctg
atcgacaagtggagcgacatccgcccggtggccttcggcggcatgctggcggaatgcctg
gtcggcgtcatggcgctgatcgccgccacctcgctgcatccggccgactacttcgccatc
aactcggcgccggccgccttcaaggccctgggcatggacgtcgtcgacctgccgcggctg
agccaggacatcggcctcgacctctatggccgcaccggaggcgctgtgacgctggcggtc
ggcatgaccgagatcttcacccgcgtgccgtggttcaacagcctcgcctcctacttcttc
cagttcgtcgtgatgttcgaggcggtgttcatcctgaccgcggtggacagcggcacccgc
gtcgcccgttacctgatccaggatctgctgggtgacctctatgccccgatgaagcggctg
gactgggttcccggatcgatcatcgccagcgtcatcgcctgcgtcgcctggggttatctg
ctgacgtcgggcgacatcaactcggtctgggccctgttcggcgtgtccaaccagctgatg
gcctcggtcggcctgatcatcggcgccaccatcatcctgcggctggcccagaagcgggtc
tatatgctgacctgcctgatcccgctggcctacctgttcgtcacggtgaacgccgccggc
tactggatgatcgccaacgtctatctgaacacggcgtccaagggctacaaccccttcaac
gccggcatctcgatcatcatgctggcgctgggcttcgtcatcctgatcgccgcgctcagg
aagtggaaggacctgctgcaaacccgcgccatcgaggtgccgatggtcgccaccccggcg
gaatga

DBGET integrated database retrieval system