KEGG   Azospirillum sp. B510: AZL_e04050Help
Entry
AZL_e04050        CDS       T01169                                 

Gene name
lytR
Definition
(GenBank) two-component system, LytT family, response regulator
  KO
K02477  two-component system, LytTR family, response regulator
Organism
azl  Azospirillum sp. B510
Brite
KEGG Orthology (KO) [BR:azl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:azl02022]
    AZL_e04050 (lytR)
Two-component system [BR:azl02022]
 LytTR family
  Unclassified
   AZL_e04050 (lytR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg LytTR
Motif
Other DBs
NCBI-ProteinID: BAI76750
RhizoBase: AZLe04050
UniProt: D3P7X1
Position
pAB510e:complement(522676..523392)
Genome map
AA seq 238 aa AA seqDB search
MTVLIVDDEPLAREELRRMLEEAADIRIVGECANAIEAIGAINRQAPDIVFLDIQMPRVS
GLEMLGMLDPERMPRIVFLTAHDDYAVQAFEEHAFDYLLKPADPARLEKTLQRLRRQRAP
QEVAVLPGAAELRHIPCTGVNRITLMKLADVEYVVSRPAGVYVVGEDGQERFTELTLHTI
QEKSQLFRCHRQYLVNPERIREIRFADGGLAEIQTIGGHAVPVSRRFLGALKERLGMG
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcctgatcgtcgatgacgagccgctggcgcgcgaggagctgcgccggatgctg
gaggaggccgccgacatccgcatcgtcggcgaatgcgccaacgccatcgaggcgatcggc
gccatcaaccggcaggcacccgacatcgtcttcctcgacatccagatgccgcgggtcagc
gggctggagatgctgggcatgctggatcccgaacggatgccgcgcatcgtcttcctgacc
gcccatgacgactatgccgtccaggccttcgaggagcacgccttcgactatctgctgaag
ccggccgatccggcgcggctggagaagacgttgcagcgcctgcgccgccagcgcgccccg
caggaggtcgccgtgctgccgggagcggcggaactgcgtcacatcccctgcaccggcgtc
aaccgcatcaccctgatgaagctggccgatgtggaatatgtcgtctcccgccccgccggg
gtctatgtggtgggggaggacgggcaggagcgcttcaccgagctgaccctgcacaccatc
caggaaaagagccagctgttccgctgccaccgccagtatctggtcaatcccgagcgcatc
cgggaaatccgcttcgccgatggtgggctggcggagatccagaccatcggcggccatgcg
gtgccggtcagccggcgcttcctgggcgcgctgaaggagcggctcgggatgggctga

DBGET integrated database retrieval system