KEGG   Azospirillum sp. B510: AZL_e04140Help
Entry
AZL_e04140        CDS       T01169                                 

Gene name
spo0J
Definition
(GenBank) chromosome partitioning protein
  KO
K03497  chromosome partitioning protein, ParB family
Organism
azl  Azospirillum sp. B510
Brite
KEGG Orthology (KO) [BR:azl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:azl03000]
    AZL_e04140 (spo0J)
   03036 Chromosome and associated proteins [BR:azl03036]
    AZL_e04140 (spo0J)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:azl04812]
    AZL_e04140 (spo0J)
Transcription factors [BR:azl03000]
 Prokaryotic Type
  Other transcription factors
   Others
    AZL_e04140 (spo0J)
Chromosome and associated proteins [BR:azl03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    AZL_e04140 (spo0J)
Cytoskeleton proteins [BR:azl04812]
 Prokaryotic cytoskeleton proteins
  MinD / ParA class of bacterial cytoskeletal proteins
   AZL_e04140 (spo0J)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ParBc HTH_37
Motif
Other DBs
NCBI-ProteinID: BAI76759
RhizoBase: AZLe04140
UniProt: D3P7Y0
Position
pAB510e:complement(535361..536212)
Genome map
AA seq 283 aa AA seqDB search
MGVMSGGLTVGSDRLFGTSAGFPHVVELDLARVHRNPDQPRRHFDEAELRSLAASIERHG
LQNPILVRPLPQGEYLLIGGERRVRAHEMLGRKTVFAILTSGDPDEIGLIDNVQRVDLNA
VEYAAALARLIDKHGYTHDELAAVVGRDRTDVTKLLAIMGLPAEMREEYATRFAHVSRSV
MIEIAAAPAELHAQLWKRAKEGASVKAVRQAKREHAQGGATDAAAPEPDAGEAVRTLQAS
VARILRDVAVVRERRRHLDADSRDRLLRLRAEIDAILDGEAGA
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgggggtgatgtccggcgggctgacggtgggcagcgaccggctgttcggcacctcggcc
ggcttcccccatgtggtggagctggatctcgcccgtgtccatcgcaacccggaccagccc
cgccgccatttcgacgaggcggagctgcgcagcctggccgcctccatcgagcgtcacggg
ttgcagaacccgatcctggtgcgtccgctgccccagggcgagtatctgctgatcggcggc
gagcggcgggtgcgcgcgcatgagatgctgggtcgcaagacggtcttcgccatcctgacg
tccggcgatcccgatgagatcgggctgatcgacaatgtccagcgcgtcgacctgaacgcg
gtggaatatgcggcggcgctggcccggctgatcgacaagcacggctacacccatgacgag
ctggccgccgtcgtcgggcgcgaccgcaccgacgtcaccaagctgctggcgatcatgggc
ctgccggcggagatgcgggaggaatatgcgacgcggttcgcccatgtctcgcgctcggtg
atgatcgagatcgccgccgccccggcggagctgcatgcgcagctgtggaaacgcgccaag
gagggggcgagcgtcaaggcggtgcggcaggccaagcgcgagcatgcccagggcggggcc
acggacgcggctgcgccggagccggacgccggggaggcggtgcggaccctccaggccagc
gtggcgcggatcctgcgcgatgtggccgtggtgcgcgagcggcgccgccacctcgacgcc
gacagccgcgaccggcttttgcggctgcgggccgagatcgacgcgatcctggatggggaa
gcgggcgcctaa

DBGET integrated database retrieval system