KEGG   Azospirillum sp. M2T2B2: DM194_19005Help
Entry
DM194_19005       CDS       T05500                                 

Definition
(GenBank) NAD(P)-dependent oxidoreductase
  KO
K05886  serine 3-dehydrogenase (NADP+) [EC:1.1.1.276]
Organism
azm  Azospirillum sp. M2T2B2
Brite
KEGG Orthology (KO) [BR:azm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DM194_19005
Enzymes [BR:azm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.276  serine 3-dehydrogenase (NADP+)
     DM194_19005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase NAD_binding_10 RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: AWU96372
UniProt: A0A2U9SA99
Position
unnamed7:585706..586479
Genome map
AA seq 257 aa AA seqDB search
MSNLAPQIALVTGATSGFGDAIARRLAAEGWRIVATGRRWDRLDALVEALGGPAVVHPLC
FDIRDEEATRAALASLPAEFAGISVLVNNAGLALGTGAAQDCGLEQWRAMIDTNVTGLVT
ITRLLLDRLIARRGLIVNLASIASNWPYPGGNVYAGTKAFVKQFSLGLRSDLSAQGVRVT
SIEPGLSESEFTLVRTGGDKAAYDALYAGADPLQPEDIAETVRWVVSLPPHVNINSVEVM
PVSQSWAPFRIHRQTPA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacttagccccgcagatcgctctcgtcacgggcgccacctccggcttcggcgac
gccatcgcccggcggctggcggcggagggctggcggatcgtcgccaccggccggcgctgg
gaccggctggacgccctggtcgaggcgctgggcgggccggcggtggtccatccgctgtgc
ttcgacatccgcgacgaggaggcgacgcgcgccgccctggcctccctgccggcggaattc
gccggcatctccgtcctggtcaacaacgccgggctggcgctgggcaccggggccgcgcag
gactgcggcctggagcagtggcgggccatgatcgacaccaacgtcaccgggctggtgacc
atcacccggctgctgctggaccggctgatcgcgcggcgcgggctgatcgtcaatctcgcc
tccatcgcctccaactggccctatcccggcggcaacgtctatgccggcaccaaggccttc
gtgaagcagttctcgctcggcctgcgcagcgatctgtcggcgcagggcgtgcgcgtgacc
tccatcgagccgggcctgtcggaaagcgaattcaccctggtccgcaccggcggcgacaag
gcggcctatgacgcgctctatgccggcgccgacccgctgcagccggaggacatcgccgag
acggtgcgctgggtggtgtcgctgccgccccacgtcaacatcaacagcgtggaggtcatg
ccggtcagccagtcctgggcgccgttcagaatccaccgccaaacccccgcctga

DBGET integrated database retrieval system