KEGG   Azospirillum sp. M2T2B2: DM194_20015Help
Entry
DM194_20015       CDS       T05500                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
azm  Azospirillum sp. M2T2B2
Pathway
azm00430  Taurine and hypotaurine metabolism
azm00620  Pyruvate metabolism
azm00640  Propanoate metabolism
azm00680  Methane metabolism
azm01100  Metabolic pathways
azm01120  Microbial metabolism in diverse environments
azm01200  Carbon metabolism
Module
azm_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:azm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DM194_20015
   00640 Propanoate metabolism
    DM194_20015
  09102 Energy metabolism
   00680 Methane metabolism
    DM194_20015
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    DM194_20015
Enzymes [BR:azm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     DM194_20015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AWU96598
UniProt: A0A2U9SFN9
Position
unnamed2:complement(132008..133234)
Genome map
AA seq 408 aa AA seqDB search
MVAHSHSGSNACLVINAGSSSLKFSVFQDGADAELKPVVTGQISGIGTAPRFEAKDAARH
KIADHSWAGGETPGRAELLHHLLDWIGDTLKGATLVAAGHRVVHGGTRFSAPVRVTPTVL
DQLEELIPLAPLHEPHNIAAIRALAQVYPSLPQVACFDTAFHQTQPWQSQTFAIPRELTA
EGIRRYGFHGLSYEYIAHRLPQLAPELADGHVVVCHLGSGASLCAMHAGRSVDTSMGFTA
LDGVPMGTRPGAIDPGVLIYLMREKGYGADELEKLLYHKSGMLGVSGISNDMRDLESSDL
PAAAEAVELFCHNVAKQVAALAGSMGGLDAVVFTAGVGENSTLVRERVAEKLGWLGVSID
AAANRAKATRISAEDSRVPVFIIPTDEERMIARHTLGVIAAETMSQAA
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggttgcacattcccattccggcagcaacgcctgcctcgtcatcaatgccggctcctca
agcctgaaattctcggtcttccaggatggcgccgacgccgagctgaagccggtcgtcacc
ggccagatctccggcatcggcacggctccccgcttcgaggcgaaggacgccgcccgccac
aagatcgccgaccacagctgggccggcggtgagactccgggccgcgccgagcttctgcac
catctgctcgactggatcggcgacacgctgaagggcgccacgctggtcgccgccggccat
cgcgtcgttcatggcggcacccgcttctcggccccggtgcgcgtcaccccgacggtgctc
gaccagttggaggagctgatcccgctggcgccgctgcacgagccgcacaacatcgccgcc
atccgggcgctggcgcaggtctatccgtcgctgccgcaggtggcctgcttcgacaccgcc
ttccaccagacccagccctggcagtcgcagaccttcgccatcccgcgcgaactgacggcg
gaaggcatccggcgctacggcttccacggcctcagctacgagtacatcgcccatcgcctg
ccgcagctggcgccggaactggccgacggccatgtggtggtctgtcatctcggcagcggc
gccagcctgtgcgccatgcatgccgggcgcagcgtcgacacctccatgggcttcaccgcg
ctggacggcgtgccgatgggcacccggccgggcgcgatcgaccccggcgtgctgatctac
ctgatgcgcgagaagggctacggcgccgacgagctggaaaagctgctctaccacaagtcg
ggcatgctgggcgtgtcgggcatctccaacgacatgcgcgacctggagagttccgacctg
ccggccgcggccgaggctgtcgagctgttctgccacaacgtcgccaagcaggtggcggcg
ctcgccggctcgatgggcgggcttgacgccgtggtgttcaccgcgggcgtgggcgagaac
tccacgctggtccgtgagcgggtcgcggagaagctgggctggctcggcgtgtcgatcgac
gcggcggccaaccgggcgaaggcgacgcgcatctccgccgaggacagccgggtgccggtg
ttcatcatcccgaccgacgaggaacggatgatcgcccgccacaccctgggcgtcatcgcc
gccgagacgatgagccaggcggcttaa

DBGET integrated database retrieval system