KEGG   Azospirillum sp. M2T2B2: DM194_23605Help
Entry
DM194_23605       CDS       T05500                                 

Definition
(GenBank) low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
azm  Azospirillum sp. M2T2B2
Pathway
azm00260  Glycine, serine and threonine metabolism
azm01100  Metabolic pathways
azm01110  Biosynthesis of secondary metabolites
azm01120  Microbial metabolism in diverse environments
azm01130  Biosynthesis of antibiotics
azm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:azm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DM194_23605
Enzymes [BR:azm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     DM194_23605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AWU97272
UniProt: A0A2U9SCQ9
Position
unnamed3:complement(289852..290886)
Genome map
AA seq 344 aa AA seqDB search
MYDFRSDNVAGAAPQVMTALAASSSGTAAPYGNDPWTVRVTERLCAIFETEVAVFPVATG
TAANALALSALVPPYGAVLCHDEAHIAIDECGAPEFFTGGAKLVPLAGEHGKLTPDAVSR
HIARAGVGVVHRVQPAALSLTQATEAGTVYTPAEVEALVEAAHSNGMAVHMDGARFANAI
ARLGCAPADVTWRAGVDVLTLGGTKGGCLAAEAVVFFNPAMAEDFGFGRKRGGHLVSKMR
FLSAQLDAWLADGLWLSLAAHANAMADRLTAGLTALPGVELAHPVEANELFVRLPAAYAE
ALEGAGYGFYRWDDGTARFVTAFDTPAAAVDGLLGILRSLQEKA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgtatgacttccgcagcgacaatgtcgccggtgccgcgccccaggtgatgacggcgctg
gcggcatcgtcgtccggcaccgccgccccctacggcaacgatccctggacggtgcgggtg
acggagcggctgtgcgcgatcttcgagaccgaggtcgcggtcttcccggtcgccaccggc
accgcggccaacgcgctggcgctgtcggcgctggtgccgccctatggcgccgtgctgtgc
catgacgaggcccacatcgccatcgacgaatgcggcgcgccggagttcttcaccggcggc
gccaagctggtcccgctggccggcgagcatggcaagctgacgcccgacgcggtgtcgcgc
cacatcgccagggccggcgtcggcgtggtccaccgcgtgcagcccgccgccctcagcctg
acccaggcgaccgaggccggcaccgtctataccccggcggaggtcgaggctctggtcgag
gccgcccattccaacggcatggccgtgcatatggacggcgcccgcttcgccaacgccatc
gcccggctgggctgcgcgccggccgacgtgacgtggcgggccggggtcgacgtgctgacg
ctgggcggcaccaagggcggctgcctcgccgccgaggcggtggtgttcttcaacccggcg
atggccgaggatttcggcttcggccgcaagcgcggcggccatctggtgtcgaagatgcgc
ttcctgtcggcgcagctcgacgcctggctggccgacggcttgtggctgagcctcgccgcc
cacgccaacgcgatggccgaccggctgaccgccgggctgaccgcgcttcccggcgtcgag
ctggcccatccggtcgaggccaacgagctgttcgtccgcctgccggcggcatatgccgag
gcgttggagggggccggctacggcttttaccgttgggatgacggcaccgcgcgattcgtg
acggcgttcgacacgccggcggcggcggtggacggcttgctgggtattttgcgcagtctg
caagaaaaggcttga

DBGET integrated database retrieval system