KEGG   Azospirillum sp. M2T2B2: DM194_27290Help
Entry
DM194_27290       CDS       T05500                                 

Definition
(GenBank) SDR family NAD-dependent epimerase/dehydratase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
azm  Azospirillum sp. M2T2B2
Pathway
azm00520  Amino sugar and nucleotide sugar metabolism
azm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:azm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    DM194_27290
Enzymes [BR:azm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     DM194_27290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase NAD_binding_4 RmlD_sub_bind 3Beta_HSD Polysacc_synt_2 adh_short
Motif
Other DBs
NCBI-ProteinID: AWU97981
UniProt: A0A2U9SG16
Position
unnamed5:205926..206882
Genome map
AA seq 318 aa AA seqDB search
MPALTNRKRVLVTGGAGFLGSHLCERLLAAGHDVLCVDNFFTGSRDNVLHLLGNPHFELM
RHDVTFPLYVEVDEIYNLACPASPIHYQHDPVQTTKTSVHGAINMLGLAKRVGARIMQAS
TSEVYGDPAVHPQPEEYWGNVNTIGPRACYDEGKRCAETLFFDYHRQHRLDIKVIRIFNT
YGPRMHPNDGRVVSNFIIQALKGEPITIYGDGQQTRSFCYVDDLIEGFLRFMDTPAGVTG
PINLGNPGEFTMLELAEKVIRLTGSASTIEHKPLPQDDPKQRRPDITKARGLLDWEPAVP
LDEGLDRTIAYFRGRFFA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
ttgccggctctcaccaaccgaaagcgtgtcctcgtcaccggcggcgccgggttcctgggc
tcccacctgtgcgagcggcttctggcggccgggcacgacgtgctgtgcgtcgacaacttc
ttcaccggcagccgcgacaacgtcctgcacctgctgggcaacccgcatttcgagctgatg
cgccacgacgtgacgtttccgctctatgtcgaggtggacgagatctacaacctcgcctgc
ccggcctcgccgatccattaccagcacgaccccgtgcagacgaccaagaccagcgtgcac
ggcgccatcaacatgctggggctggccaagcgggtcggcgcgcgaatcatgcaggcctcg
acctcggaggtctacggcgacccggcggtgcatccgcagcccgaggaatattggggcaac
gtcaacaccatcggcccgcgcgcctgctatgacgagggcaagcgctgcgccgagacgctg
ttcttcgactatcaccgccagcaccggctggacatcaaggtcatccgcatcttcaacacc
tacggcccgcgcatgcatcccaacgacgggcgcgtggtgtcgaacttcatcatccaggcg
ctgaagggcgagccgatcaccatctacggcgacggccagcagacgcgctccttctgctat
gtcgacgacctgatcgaaggcttcctgcgcttcatggacacgccggccggcgtcaccggc
ccgatcaacctgggcaaccccggcgagttcaccatgctggaactggcggagaaggtgatc
cgcctgaccggctcggcctcgacgatcgagcacaagccgctgccgcaggacgaccccaaa
cagcgccgtcccgacatcaccaaggcgcgcggcctgctggactgggaaccggcggtgccg
ctggacgaggggctggaccgcaccatcgcctatttccgcgggcgcttcttcgcctga

DBGET integrated database retrieval system