KEGG   Azoarcus olearius BH72: azo0224
Entry
azo0224           CDS       T00441                                 

Definition
(GenBank) hypothetical outer membrane efflux protein
  KO
K15725  outer membrane protein, heavy metal efflux system
Organism
azo  Azoarcus olearius BH72
Brite
KEGG Orthology (KO) [BR:azo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:azo02000]
    azo0224
Transporters [BR:azo02000]
 Other transporters
  Pores ion channels [TC:1]
   azo0224
SSDB
Motif
Pfam: OEP
Other DBs
NCBI-ProteinID: CAL92841
RhizoBase: azo0224
UniProt: A1K1Y6
Position
247500..248717
AA seq 405 aa
MAACAIAGSMICCAALAQTTAPRVGLARALDAAWQRTQAGTEAQVALARAEAEQAAADSL
LPEPPALELSHRSDRWHDNKGARENEVGLALPLWLPGQRSARQAAAEAGQALARSGEDAD
RLRLAGEVREAAWALAGLDAEAAVAEAQLRYLRELAADVERRVQAGELARTDAIAARAEA
LAAQAALSEARERRHAAMTRWQTLTGLDAPADPREADTVPDAAGDDGLPATHPGLRLAAQ
AVEHARRGVEVARTDRAAPPELTLSYRREVGESGAAAERSINVGLRVPFGTDARNRPLAA
AAQGELAQAQVAELRLRQQLAGDLLVARGALQAAQAQAEAARERAGLLRERAQLIDKAFR
AGEAALPELLLAASAATQGEAGRARQDAALGLARARLQQVSGILP
NT seq 1218 nt   +upstreamnt  +downstreamnt
atggctgcctgcgcgatcgccggcagcatgatctgctgcgccgcactggcgcagaccaca
gcgccgcgggtcggcctggcgcgcgcgctcgacgccgcctggcaacgcacccaggccggc
accgaagcgcaggtggcgctggcgcgcgccgaggccgagcaggccgcggccgacagcctg
ctgccggaaccgccggcgctcgaactgagccaccgctccgaccgctggcacgacaacaag
ggcgcgcgcgaaaacgaagtcggcctcgcgctgccgctgtggctgccgggccagcgctcg
gcgcgccaggccgcggccgaagccggccaggcgctcgcccgcagcggcgaggatgccgac
cgcctgcgcctggccggcgaagtgcgcgaggccgcgtgggcgctggccgggctggacgcc
gaagcggcggtggccgaggcccagctgcgctacctgcgcgaactggccgccgatgtcgag
cgccgcgtccaggcgggcgaattggcgcggaccgatgcgatcgcggcgcgtgccgaggcg
ctcgcggcgcaggccgcgctcagcgaagcgcgcgaacgccgccacgccgcgatgacgcgc
tggcagacgctgaccggcctggatgcgccggccgatccgcgcgaggccgacactgtcccg
gacgctgcgggcgacgacggcctgcccgccacccaccccggcctgcgcctggccgcgcag
gcagtggagcatgcccgccgcggtgtcgaggtggcgcgcaccgaccgcgccgcgccgccc
gagctgacgctgagctaccgccgcgaagtcggcgaaagcggcgccgcggccgagcgcagc
atcaacgtcggcctgcgcgtacccttcggcaccgacgcccgcaaccggccgctggccgcc
gcggcgcagggcgagctggcgcaggcccaggtcgccgagctgcgcctgcgccagcaactc
gccggcgacctgctggtggcgcgcggcgcactccaagccgcgcaggcccaggccgaggcc
gcccgcgaacgcgccggcctgttgcgcgaacgcgcccagctcatcgacaaggccttccgt
gccggcgaggccgcgctgcccgagctgctgctcgccgcgtccgccgccacccagggcgaa
gccggccgcgcccgccaggacgccgcgctcggcctggcccgcgcccgtctccaacaagtt
tccggaatcctgccatga

DBGET integrated database retrieval system