KEGG   Azoarcus sp. BH72: azo0393Help
Entry
azo0393           CDS       T00441                                 

Gene name
fadAx
Definition
(GenBank) probable acyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
azo  Azoarcus sp. BH72
Pathway
azo00071  Fatty acid degradation
azo00072  Synthesis and degradation of ketone bodies
azo00280  Valine, leucine and isoleucine degradation
azo00310  Lysine degradation
azo00362  Benzoate degradation
azo00380  Tryptophan metabolism
azo00620  Pyruvate metabolism
azo00630  Glyoxylate and dicarboxylate metabolism
azo00640  Propanoate metabolism
azo00650  Butanoate metabolism
azo00900  Terpenoid backbone biosynthesis
azo01100  Metabolic pathways
azo01110  Biosynthesis of secondary metabolites
azo01120  Microbial metabolism in diverse environments
azo01130  Biosynthesis of antibiotics
azo01200  Carbon metabolism
azo01212  Fatty acid metabolism
azo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:azo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    azo0393 (fadAx)
   00630 Glyoxylate and dicarboxylate metabolism
    azo0393 (fadAx)
   00640 Propanoate metabolism
    azo0393 (fadAx)
   00650 Butanoate metabolism
    azo0393 (fadAx)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    azo0393 (fadAx)
   00072 Synthesis and degradation of ketone bodies
    azo0393 (fadAx)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    azo0393 (fadAx)
   00310 Lysine degradation
    azo0393 (fadAx)
   00380 Tryptophan metabolism
    azo0393 (fadAx)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    azo0393 (fadAx)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    azo0393 (fadAx)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    azo0393 (fadAx)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:azo04147]
    azo0393 (fadAx)
Enzymes [BR:azo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     azo0393 (fadAx)
Exosome [BR:azo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   azo0393 (fadAx)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: CAL93010
RhizoBase: azo0393
UniProt: A1K2F5
Position
419104..420315
Genome map
AA seq 403 aa AA seqDB search
MSDPVVIVSVARTPMGGFQGDLSGLTGPQLGAIAIKSAVERARLAPEQVQEVIMGCVLPA
GVGQAPARQAALGAGLPLAAGCTTINKVCGSGMKATMLAHDLLLAGTNEVMVAGGMESMS
NAPYLLPKARGGYRLGHGQLLDHMFLDGLEDSYSKENKGRLMGTFAEDCAGHFDFSRSAQ
DAFAVASTERAQAAITEGAFSWEVVPVTVAGRKGDVVVDKDEQPLKAQLDKIGTLKPAFK
KDGTVTAANSSSISDGAAALVLMRKSTADKLGLAPLATIVGHATHAQEPQWFTTAPVGAM
QKVLAKAGWGVGDVDLWEINEAFAVVTMAAMKELNLPHDKVNVNGGACALGHPIGASGAR
ILVTLIGALRRRGLKRGVASLCIGGGEATAMAIELNASVACGG
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatcccgtagtcatcgtttccgtcgcccgcacgccgatgggcggcttccagggc
gatctttccggcctcaccgggccgcagctcggcgccatcgcgatcaagtcggcggtggag
cgcgcgcgtcttgcgcccgagcaggtgcaggaggtgatcatgggttgcgtgctgccggcc
ggcgtcggccaggcgccggcgcgtcaggcggcactcggtgccgggctgccgctggcggcg
ggctgcacgaccatcaacaaggtctgcgggtccggcatgaaggcgacgatgctggcccac
gacctcctgttggcgggcaccaacgaggtgatggtggcgggcggcatggagtcgatgtcg
aacgcgccgtatctgttgccgaaggcgcgcggcggttatcgcctgggccacggccagttg
ctcgaccacatgttcctcgacgggctggaagacagctattcgaaggagaacaagggccgg
ctgatgggcacctttgccgaggattgcgccggccatttcgatttcagccgcagcgcgcag
gacgcgttcgcggtggcctccaccgagcgcgcgcaggcggcgatcaccgaaggcgccttc
agctgggaagtggtgccggtgacggtggccgggcgcaagggcgatgtggtggtggacaag
gacgagcagccgctgaaggcgcagctcgacaagatcggcacgctgaagccggcgttcaag
aaggacggcacggtgaccgcggcgaattcgtcgtcgatttcggatggtgcggcggcgctg
gtgctgatgcgcaagtcgacggccgacaagctggggctggcgccgctggcgaccatcgtc
ggccacgccacccacgcgcaggagccgcagtggttcaccaccgcgccggtgggggcgatg
cagaaggtgctggcgaaggcgggctggggcgtgggcgacgtcgatctgtgggagatcaac
gaggccttcgcggtggtgacgatggcggcgatgaaggagctgaacctgccgcacgacaag
gtcaatgtgaatggcggcgcatgtgcgctgggccatccgatcggcgcgtccggtgcccgc
atcctggtgacgctgatcggtgcgctgcgccggcgcgggctgaagcgcggcgtggccagc
ttgtgcatcggcggcggcgaggccacggcgatggcgatcgaactcaacgcatcggtggcc
tgcggcggttga

DBGET integrated database retrieval system