KEGG   Azoarcus sp. BH72: azo0756Help
Entry
azo0756           CDS       T00441                                 

Gene name
ispE
Definition
(GenBank) probable 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
azo  Azoarcus sp. BH72
Pathway
azo00900  Terpenoid backbone biosynthesis
azo01100  Metabolic pathways
azo01110  Biosynthesis of secondary metabolites
azo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:azo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    azo0756 (ispE)
Enzymes [BR:azo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     azo0756 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: CAL93373
RhizoBase: azo0756
UniProt: A1K3G8
Position
complement(807698..808546)
Genome map
AA seq 282 aa AA seqDB search
MTISGVLAGCPAPAKLNLFLHVVGRRDDGYHLLQTAFRLLDWGDRLDFRVRDDGLIRRTN
QVAGVAEDDDLVVRAARRLQQATGTPLGADITLHKVLPMGGGVGGGSSDAATTLIALNHL
WQTGLTRADLQQLGLALGADVPFFIYGRDAFAEGVGEAFQPLALPAAVYVVLSPEVSVPT
AEIFSAKGLTRDTPPIRIADFAASPTRNDLQATACSRYPEVARAINWLEHYAPARMTGSG
ACVFAEVASEIEADEIVSLCPARWKAWKAKSLARHPLYGLLD
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcagcggtgtcctcgccggctgccccgcgccggccaagctgaacctgttcctg
catgtcgtcggacgccgcgacgacggctaccacctgctgcagaccgcgttccggctgctc
gactggggcgaccgcctggacttccgcgtgcgcgacgacggtctcatccgccgcaccaac
caggtggccggcgtcgccgaggacgacgatctggtcgtgcgcgccgcgcgccgcctgcag
caggccacaggcacgccgctcggtgcggacatcacgctgcacaaggtattaccgatggga
gggggcgtcggcggtggcagttcggacgccgcgaccacactgattgcgctcaaccatctg
tggcagaccggcctcacccgcgccgacctgcaacagctcgggctcgcgctcggcgccgac
gttccgttcttcatctatggccgcgacgcctttgccgagggcgtgggcgaagccttccag
ccgctggcgctgcctgcagccgtgtatgtggtgctgtcaccggaggtcagcgtgcccacc
gccgagattttttcagcaaagggcttgactcgggatacacccccaatcagaatagcggac
ttcgcagcgagccctacccgaaacgacttacaagcaacggcctgtagtcgatatccggaa
gtagcacgggcaataaactggctggagcactacgcgccagcgcggatgaccggctcaggc
gcatgcgtgtttgccgaggtggcttcggaaatcgaagcagacgaaatcgtcagcctctgt
cctgcacgctggaaagcctggaaggcaaaaagcctggcgcggcatccgttgtacggtttg
ctcgactag

DBGET integrated database retrieval system