KEGG   Azoarcus sp. BH72: azo1018Help
Entry
azo1018           CDS       T00441                                 

Gene name
rluD
Definition
(GenBank) pseudouridylate synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
azo  Azoarcus sp. BH72
Brite
KEGG Orthology (KO) [BR:azo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:azo03009]
    azo1018 (rluD)
Enzymes [BR:azo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     azo1018 (rluD)
Ribosome biogenesis [BR:azo03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    azo1018 (rluD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 DMA DUF1507
Motif
Other DBs
NCBI-ProteinID: CAL93635
RhizoBase: azo1018
UniProt: A1K480
Position
1094663..1095637
Genome map
AA seq 324 aa AA seqDB search
MNEPEDYSPGDPDARASLPAPRRVPVELAGARLDQVLARLFPEHSRSRLQAWLKDGLIRL
DGMERQAKHKVHGGEELVVAGLPPLPEQLAFEPEAIPLDVVYEDASILVIDKPAGLVVHP
GSGNWSGTLLNALLHHAPALAGLPRAGIVHRLDKDTTGLMVVAKTLEAQTDLVRQLQQRT
VARHYYALVYGDIASDGEIDADIDRHPVQRTRMAVVPGGRPALTRYAVRQRLHGLTLVEC
RLQTGRTHQIRVHMAHLGHPLVGDPVYGPRRVTDSRVDGFSRQALHAFRLGLLHPASGED
MVWSAPLPADFAALLEKVGGRADA
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
ttgaatgaacccgaggattatagcccaggcgaccccgacgcccgggcttccctgccagcg
ccgcgccgggttcccgtcgaactggccggcgcccgcctcgaccaggtattggcgcggctt
ttccccgagcattcgcgcagccgcctgcaggcctggctgaaggatgggctgatccggctg
gacggtatggagcgccaggccaagcacaaggtgcatggcggcgaggaactggtcgtggca
gggctgccacccttgcccgagcaactggcgttcgagccggaggcgattccgctcgatgtc
gtgtacgaggacgcctcgatcctcgtcatcgacaagccggcggggctcgtggtccacccg
ggcagcggcaactggagcggtacgctgctcaacgccctgttgcaccacgccccggcgctc
gcgggcttgccccgggcgggcatcgttcatcggctggacaaggacaccaccggtttgatg
gtggtggcaaagacgctggaggcgcagaccgatctggtgcgccagctccagcagcgcacg
gtggcgcgccactactacgcgctggtctatggcgacatcgccagtgatggcgaaatcgat
gccgacatcgatcgccacccggtgcagcgcacgcgcatggcagtggtgcccggggggcgg
ccggcgctgacacggtatgccgtgcggcagcgcttgcacggactgaccctggtcgagtgc
cggttgcagaccgggcgcacgcaccagatccgggtacacatggcgcacctcggccacccg
ctcgtcggcgatccagtgtatggcccccgtcgcgtgacggattcccgggtggacgggttt
tcgcgacaggccttgcacgcattccggctgggcttgctgcaccctgcgtcgggggaggac
atggtgtggtccgcgccgcttccggccgacttcgccgccttgctcgagaaggtcggcggg
cgggcagacgcatga

DBGET integrated database retrieval system