KEGG   Azoarcus sp. BH72: azo1048Help
Entry
azo1048           CDS       T00441                                 

Gene name
trpA
Definition
(GenBank) TrpA protein
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
azo  Azoarcus sp. BH72
Pathway
azo00260  Glycine, serine and threonine metabolism
azo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
azo01100  Metabolic pathways
azo01110  Biosynthesis of secondary metabolites
azo01130  Biosynthesis of antibiotics
azo01230  Biosynthesis of amino acids
Module
azo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:azo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    azo1048 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    azo1048 (trpA)
Enzymes [BR:azo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     azo1048 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth Peripla_BP_6 PcrB
Motif
Other DBs
NCBI-ProteinID: CAL93665
RhizoBase: azo1048
UniProt: A1K4B0
Position
1127891..1128706
Genome map
AA seq 271 aa AA seqDB search
MSKIQTTFQRLQAQGRKALIPFITAGDPDPTLTVPLMHALVAGGADIIELGVPFSDPMAD
GPTIQRASERALAQGMTLRKVLQAVREFRSGDADTPVVLMGYANPIEAMGQQAFVAAARE
AGVDGALVVDYPPEECVEFAAASKAAGLDPIFLLAPTSSEQRFADVARAGSGYIYYVSLK
GVTGAGTLDLDEVARRIPQIRAAVGMPVGVGFGIRDAESARRIGAVADAVVIGSRIIEEI
ERSPREQACSNVTHFVKGIREALDTLPGVKQ
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaaatccagaccactttccagcgccttcaggcccagggccgcaaggcgctgatc
ccgttcatcaccgcgggcgatcccgaccccacgctgacggtgccgctgatgcatgcgctc
gttgcgggcggggcggacatcatcgagttgggggtcccgttctccgaccccatggctgac
ggcccgaccatccagcgtgcttccgagcgcgcattggcgcagggcatgaccttgcgcaag
gtgctgcaggccgtgcgcgagttccgcagcggggatgccgacaccccggtggtactgatg
ggttacgccaatccgatcgaggcgatgggccagcaggcctttgtcgccgcagcccgcgaa
gccggcgtggacggcgcgctcgtggtggattacccgcccgaagagtgcgtcgaattcgcc
gcggccagcaaggcggccgggctcgacccgatcttcctgctcgcgccgacgtcgtcggaa
cagcgctttgcggacgtcgcccgggcgggcagcggctacatctactacgtctcgctgaag
ggcgtgaccggcgctggcacgctggatctggacgaggtcgcgcgccgcattccgcagatc
cgcgctgcggtgggcatgccggtgggcgtggggttcggcatccgtgacgccgaaagcgcg
cgacggatcggcgccgtggccgatgcggtggtgatcggcagccgcatcatcgaagagatc
gaacgcagcccgcgcgagcaggcctgcagcaatgtcacccacttcgtgaagggcatccgc
gaagccctcgataccctgcccggagtcaagcaatga

DBGET integrated database retrieval system