KEGG   Azoarcus sp. BH72: azo1279Help
Entry
azo1279           CDS       T00441                                 

Definition
(GenBank) putative cytochrome C peroxidase
  KO
K00428  cytochrome c peroxidase [EC:1.11.1.5]
Organism
azo  Azoarcus sp. BH72
Brite
Enzymes [BR:azo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     azo1279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCP_MauG Cytochrom_C Cytochrome_CBB3 DHOR DUF1924
Motif
Other DBs
NCBI-ProteinID: CAL93896
RhizoBase: azo1279
UniProt: A1K4Z1
Position
complement(1378734..1379822)
Genome map
AA seq 362 aa AA seqDB search
MTRLKTLFSATVKMPPVKRRALHLSIIGLLALLAVALVGLAWHDPLPELAASPTPATAIP
SNEPLLPLPPRQPPAHPARVALGQRLFHEPLLSRDRTLACASCHNLSLGGTDRRPRSIGT
GGALGQLNSPSVLNVALNFAQFWDGRVETLEAQVAGPLHNPVEMASNWAEAISRLRAQPE
YRQAFALAYAGEGISETTIADALASFERSLLPVDSPFDRYLRGDRDAIDPDAREGYTRFK
ALGCASCHQGAGIGGNMFQRFGVMGDYFGARGDITVADLGRYNVTGRDADRHVFKVPSLR
NVALTAPYFHDGNAATLDEAVAIMGRYQLGLELSAEDRRLIIAFLDTLTGQPPALAPAEP
RR
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
ttgacgcggctcaaaaccctgttttcagccacggttaagatgccgccggtgaaacgccgc
gccctccacctgtcgatcatcggtttgctcgcactgctggcggtcgcgctggtggggctc
gcctggcacgacccgctgccggaacttgccgccagtcccacgcctgcaaccgccataccc
agcaacgaaccactgctgccgctgccacccaggcagccgcctgcgcatccggcgcgggtc
gcgctcggccagcgcctgttccacgaaccgctgctgtcgcgcgaccgcacgctggcctgc
gccagctgccacaacctcagcctcgggggcaccgaccgccggccgcgctccatcggcacc
ggcggcgccctcggtcagctcaactcgccctccgtcctcaacgtcgcgctcaacttcgcg
cagttctgggacggccgcgtggaaaccctggaggcacaggtcgccgggccgctccacaac
ccggtcgaaatggcatcgaactgggccgaagcgatctcccgcctgcgcgcccagcccgaa
taccgccaagccttcgcgctcgcgtacgccggtgaaggcatcagcgaaaccaccatcgcc
gacgcactcgccagcttcgagcgcagcctgctgcccgtcgattcacccttcgaccgctac
ctgcgcggcgaccgcgacgcgatcgaccccgacgcgcgcgagggctacacccgcttcaag
gcgctcggctgcgccagctgccaccagggcgccggcatcggtggcaacatgttccagcgc
ttcggcgtgatgggcgactacttcggcgcccgcggcgacatcaccgtggcggatctcggc
cgctacaacgtgaccgggcgcgatgccgaccgccacgtcttcaaggtgcccagcctgcgc
aacgtagcgctgaccgccccgtacttccacgacggcaatgccgccacgctcgacgaggcg
gtcgcaatcatggggcgctaccagctcggcctcgaactcagcgcggaagaccgccgcctg
atcatcgccttcctcgacactctcaccggccagccgccggcgcttgcaccggctgagccc
cgccgatga

DBGET integrated database retrieval system