KEGG   Azoarcus sp. BH72: azo1303
Entry
azo1303           CDS       T00441                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
azo  Azoarcus sp. BH72
Brite
KEGG Orthology (KO) [BR:azo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:azo02044]
    azo1303
Secretion system [BR:azo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   azo1303
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: CAL93920
RhizoBase: azo1303
UniProt: A1K515
Position
1420836..1421360
AA seq 174 aa
MVRESTQKKLSRVRPPRVQITYDVEVGDAIETKELPFVLGVLGDYTGHAREQLPRLKERK
FVAIDRDNFDDVMKALAPRLGLRVPNRLSAEGGLLGVELGFAAMEDFEPQNVVAQFTPLR
RLLEARQRLAELRNKLVGSERFEALLNEAVADRDALQALKGELDARGGMHDGAR
NT seq 525 nt   +upstreamnt  +downstreamnt
atggtccgagaaagtacccagaagaagctgtcgcgcgtgcgtccgccccgcgtgcaaatc
acgtatgacgtcgaggtcggagatgccatcgaaaccaaggagctgcctttcgtactgggg
gtgctgggcgactacaccgggcatgcacgggagcagctaccccggctcaaggaaaggaag
ttcgtcgccatcgaccgcgacaacttcgacgacgtcatgaaggcgctcgcccctcggctg
gggctgcgggtgcccaaccggctgtccgccgaaggcggcctgctcggcgtagagctgggg
ttcgcagcgatggaggatttcgagccgcagaacgtggtggcgcagttcaccccgctgcgg
cgcttgctcgaggcgcggcagcgtttggccgaactgcgcaacaagctggtgggcagcgaa
cgcttcgaagccctgctcaacgaagccgtcgctgaccgcgacgccctgcaggcactgaag
ggagaactggacgctcgcggggggatgcatgacggcgcgcgatga

DBGET integrated database retrieval system