KEGG   Azoarcus sp. BH72: azo1304
Entry
azo1304           CDS       T00441                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
azo  Azoarcus sp. BH72
Brite
KEGG Orthology (KO) [BR:azo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:azo02044]
    azo1304
Secretion system [BR:azo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   azo1304
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: CAL93921
RhizoBase: azo1304
UniProt: A1K516
Position
1421344..1422837
AA seq 497 aa
MTARDEHLVRTSASPQVEAEGAGLLDSLIARSRVAVDEAEHDRTRDLIGELVQEVMSGAL
PLTCDLAASIDARIAELDELISAQLNEIMHDPEFQRLEGSWRGLKYLVDAAETGPMLKLR
MLNVSKKELIKDFRQAAEFDQGALFKKVYEEEYGTFGGAPFAALVGDYEFSRHPEDLYLL
EELAHVAAAAHAPFIGAVAPAMFGLDNFAELGRPRDLSRIFETVEYAKWKSFRASDDSRY
VGLVLPHVLGRLPYGRDTHPVDAFNFEEDVDGSDHAKYLWTSAVYSYASRLTAAFAQFGW
LAAIRGVEGGGLVEDLPLHTFRTDDGEIGAKCPTELAITDRNEKLLADLGFIALTHCKNS
DYAAFFSGQSVQRPRTYNTDAANANARLSAQLPYIFASSRIAHYLKAMMRDKVGSFASRQ
NVQDFLNAWLAQYVLLDDAASQEAKSKYPLREARVEVVEVPGRPGAYRAAAFLRPHFQLD
ELTISLRLVAELPQPAR
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgacggcgcgcgatgaacacctggtgcgcacgagcgcttctccccaggtcgaggcagag
ggtgccggactgctggattcgctgatcgcgcgcagtcgggtcgcggtggatgaggcagag
cacgaccgcacccgcgacctcatcggcgaactcgttcaggaggtcatgagcggggccctg
ccgctgacctgcgaccttgcggcatcgatcgacgcccgtatcgccgagctggatgaactc
atctcggcacagctcaacgagatcatgcacgaccccgagttccagcggcttgaaggaagc
tggcgcgggctcaagtacctggtcgacgccgcagagaccgggccgatgctcaagctgcgc
atgctcaatgtgtccaagaaggagttgatcaaggacttccgccaggcggcggagttcgat
cagggggccttgttcaagaaggtgtacgaggaggagtacggcaccttcggcggcgccccc
ttcgcggcgctggtcggggactacgagttttcccgccatcccgaggatctctatctgctc
gaggaactggcacacgtcgccgccgcggcgcacgccccgttcatcggggccgtggcgccg
gcgatgttcgggctggacaacttcgccgaactgggccggccgcgcgatctctcccggatc
ttcgaaaccgtcgagtacgcaaagtggaagtccttccgggcgagcgacgattcgcgctat
gtggggctggtactgccgcatgtgctggggcggctgccctatgggcgggatacccatccg
gtggatgcgttcaacttcgaggaggacgtggatggcagcgaccacgccaagtatctgtgg
accagcgcagtctattcctatgcgagccgcctgaccgctgcctttgcccagttcggctgg
cttgccgctatacggggggttgaagggggcgggctggttgaggatctgccgctccatacc
ttccgtaccgacgacggcgaaatcggcgccaagtgcccgaccgaacttgccataacggac
cgcaacgaaaagctgctggccgacctggggttcatcgcactgacgcactgcaagaacagc
gactacgccgcgtttttcagcggccagtcggtacagcgtccgcgtacctacaacaccgat
gccgccaatgccaatgcgcgcttgtcggcccaactgccctacatctttgcctcgtcgcgg
atcgcgcattacctgaaggcgatgatgcgcgacaaggtgggcagtttcgcctcgcgccag
aatgtccaggacttcctcaacgcgtggctcgcgcagtacgtgttgctcgacgacgcagcc
tcccaggaagcgaagtccaagtacccgctgcgggaggcgcgggtggaggtggtcgaggtg
ccggggcgccccggcgcctaccgcgcagcagccttcctgcgcccccatttccagctcgac
gaactgacgatttccctgcgcctggttgcggagctgccccaacccgcgcgctga

DBGET integrated database retrieval system