KEGG   Azoarcus sp. BH72: azo1307Help
Entry
azo1307           CDS       T00441                                 

Definition
(GenBank) probable vgr related protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
azo  Azoarcus sp. BH72
Pathway
azo03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:azo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    azo1307
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:azo02044]
    azo1307
Secretion system [BR:azo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   azo1307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_GPD T6SS_Vgr DUF2345
Motif
Other DBs
NCBI-ProteinID: CAL93924
RhizoBase: azo1307
UniProt: A1K519
Position
1423911..1426628
Genome map
AA seq 905 aa AA seqDB search
MTDSLRSAAADLLSVADAISFLPATRLVELRFAGGGPEGSPLIALSAYGEEGLNMCHRIT
VRCVAVDARIELITMLGLRAAIGIRTADGRERIRCGVVTAGVALGADGGFAAYEITVEPP
LALLRHRWGSRVFQALTVPEIVRALVEEHRGRNPIFNAGLGLRFDLQRRYECRSYCVQYH
ESDLEFIERLLAEEGIGWRFDHEEDAAGAGPSTLLVLFDAADSLPPAEPPSVRFHRGNAS
ETEDSLTSWSAQRSVGAGRTTLTSFDYKPAATTTARAEGVEEDGGDATSLEQALEDFRPQ
TLHYAPTVDGLAAYAALRQQARDAERNTFEADGDARGLTAGAWFQLEGHPRHEHEPGEER
RFVVTRLTFVARSNLPVHSSLIDAAGEGRAWAGAGKTPYQIRLTAVRRGQASAGIFPPRR
DLRPTARGPQSAIVVGPHDEEVHTDEYGRIRIQFHWQRQEDHPDGGAAYDERSSCWVRVA
LPSAGIAWGHQFIPRVGQEVLVDFLDGDIDRPVVTGVLGNGCHPPVRFSGVGALPANKAL
SGIKSREHGGAGFNELVFDDTAGQLRARLSTEHAATQLNLGCLVHPRENGQATVRGDGAE
LRTDGAAAVRGARGVLVSAHGRPRAAGSQLAREELMELLEQARELARTLSDYAGSHQGVP
AESSGADALLQAVRQWDGDRAEGADRERGDGLVCAAAPEGIVIATGATLISCAAEDHEVC
ASHQLRLTAGEGLVANAGAGIGLFAQSGDLRSIAHQGLHLTQAQQGDVVTEAARNVRVSA
AEGEVLISAPVIRLVAQDGSFLRLGGGIALGTEGAVQVKAARHSLGGPATDSIDLPVFDR
AGADQRFALLYPGAEGAEPQPAGGRRYEITLKDGRVVAGTADAEGRTDMLTSEAMQVAHI
RVFDR
NT seq 2718 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgactcgcttcgatccgctgccgccgacctgttgtcggtggcagacgctatttca
ttcctgccggcgacgcgtctggtcgaactgcggttcgccggtggcggcccagaaggcagc
cccttgatcgcattgagtgcctatggcgaggaggggctcaacatgtgccaccggatcacg
gtgcgctgcgtcgccgtggacgcacggatcgagctgataaccatgctcggcctgcgcgcg
gcgatcgggatccgcaccgcggacggacgggagcggattcgatgcggggtggtgaccgcg
ggggttgcactcggtgccgacggcggctttgcagcttacgagatcacggtggagccgcca
ctcgcgctgttgcgccaccggtggggcagcagggtgtttcaggcgctgaccgtgccggag
atcgtccgggccctggttgaggaacaccggggtcgcaaccccatcttcaatgccggcctg
gggctacgcttcgatctccagcgccgctacgagtgccgctcctactgcgtgcagtatcac
gagtccgacctcgagttcatcgaacgcctgctcgcggaagagggcatcggctggcgcttc
gaccacgaagaggacgcagcgggggccgggccctcgaccctgttggtgctgtttgacgcc
gcagacagtctcccgcccgcggagcccccatcggtccgcttccaccgcggcaacgccagc
gaaacagaggacagcctcacctcgtggtcggcccagcgcagcgtcggcgccgggcgcacg
acgctgaccagtttcgactacaagcccgccgctactaccaccgcgcgtgccgagggcgtg
gaagaagatgggggcgacgccacttcgctcgagcaggcgctggaggatttccggccgcag
accctgcactatgcgcccacggtcgatggcctcgccgcatacgcggcactccgccagcag
gcgcgggatgcggagcgcaataccttcgaggcggacggggatgcgcgtgggctgacggca
ggggcgtggttccagctggaggggcacccgcgccacgagcatgaaccgggcgaagaacgt
cgcttcgtggtgacgcgcctgacgttcgttgcgcgcagcaatcttcccgtccattcgtcg
ctgatcgacgcggcgggcgagggccgcgcctgggcaggggccggaaagacgccttatcag
atccggctgacggcggtgcgtcgggggcaggcgtctgccggcatctttccgccgcgtcgc
gacctgcgccccaccgcccgcgggcctcagagcgcaatcgtggtcgggccgcatgacgaa
gaggttcacaccgacgagtacggccgcattcgcatccagttccactggcagcggcaggaa
gatcacccggacggcggagccgcttacgacgagcgttcctcctgctgggtgcgcgtcgcg
ctgcccagcgcgggcatcgcctgggggcatcagttcattccgcgcgtcggccaggaggtc
ctggtggatttccttgacggcgacatcgaccggccggtggtgaccggcgtgctgggcaac
gggtgtcaccctccggtccgcttttccggggtcggcgcgctgcccgccaacaaggctctg
tccgggatcaagtcgcgggagcacggcggcgcgggcttcaacgagctggtgttcgacgac
acggcggggcaactgcgggcacggctgagcacggaacacgcagcgacgcagctgaacctc
ggctgccttgtccatccccgcgaaaacgggcaggcgacggtccggggtgacggggcagag
ctgcgtaccgacggcgctgccgcggttcggggtgcccgcggcgtgctggtgagtgcgcat
ggacggccgcgcgctgccggcagccagctggcacgggaagagttgatggaactgctggag
caggcgcgcgaactcgcgcgcacgctgtccgattacgcgggcagccaccagggcgttcct
gccgagagcagtggcgccgacgcgctgctgcaggcagtgcgtcaatgggatggggatcgc
gccgagggtgcagaccgggagcgcggtgacggactcgtttgcgcggccgcgcccgagggg
atcgtgattgcgaccggtgcgacgctgatcagttgcgcggccgaggatcacgaggtctgt
gccagccaccagctccggctgaccgcaggggaaggcttggtagcgaatgcgggcgccggc
atcgggctcttcgcccagtcgggcgacctgcgctcgatcgcacatcagggcctgcatctg
acccaggcccagcagggcgacgtggtgaccgaagccgcccgcaacgtccgcgtttccgcg
gccgaaggtgaagtcctgatcagcgcgccggtaatccggctcgtggcccaggacggctcc
ttcctccggttgggaggcggcatcgcgctgggaaccgaaggtgcggtgcaggtcaaggcc
gcgcgccacagcttgggcggtcccgccaccgacagcattgatctgccggtcttcgaccgt
gccggcgccgaccagcgcttcgcgttgctctaccccggcgccgagggtgcggagccgcag
cctgccggcggacggcgatacgagatcacgctgaaggatgggcgcgtcgtggccggcact
gccgacgccgagggcaggaccgacatgctgacgagcgaggccatgcaggtggcccacatc
cgtgtcttcgaccgctga

DBGET integrated database retrieval system