KEGG   Azoarcus sp. BH72: azo1647Help
Entry
azo1647           CDS       T00441                                 

Gene name
nagZ2
Definition
(GenBank) putative beta-hexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
azo  Azoarcus sp. BH72
Pathway
azo00520  Amino sugar and nucleotide sugar metabolism
azo01100  Metabolic pathways
azo01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:azo00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    azo1647 (nagZ2)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    azo1647 (nagZ2)
Enzymes [BR:azo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     azo1647 (nagZ2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: CAL94264
RhizoBase: azo1647
UniProt: A1K609
Position
1806008..1807141
Genome map
AA seq 377 aa AA seqDB search
MTSYPLSLPRGPVMIDVAGTALTDEERERLCDPLVGGVILFARNFTGSEQLAALTADIRA
LRSPQLLIAVDHEGGRVQRFRTDGFTRLPAMRSLGTLWERDHLAALDAARHTGYVLAAEL
LAHGVDLSFTPVLDLDYGVSRAIGNRAFHRDPQVVAQLAQALLAGMAEAGMGCVGKHFPG
HGYVEADSHHEVPVDDRDFDTIWNEDIAPYRHRLGRQLAGVMPAHVIYPAADPNPAGFSA
FWLKDVLRQRVGFKGVIFSDDLNMEGAALAGDILGRCKAAYEAGCDMLLVCNRPDRVAEL
LDRWAPVPDAEKLARVAAIAPVRPKAPWLADPFALELHEPYLTARGQVAAIAEDASGPTM
TAGTIGNQAVEILKKDV
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgacttcctatccgctcagcctcccccgcggcccggtgatgatcgacgtcgccggcacc
gcgctgaccgacgaggaacgcgaacgcctgtgtgacccgctggtcggcggcgtgatcctc
ttcgcccgcaacttcaccggctccgaacagctcgccgcgctcaccgcagacatccgcgcg
ctgcgcagcccgcagttgctgatcgcggtcgaccacgagggcgggcgggtgcagcgtttc
cgcaccgatggcttcacccgtctgccggcgatgcgcagtctcggcacgctgtgggagcgc
gaccatctcgccgccctcgacgccgcccgccacacgggctacgtgcttgccgccgagttg
ctggcgcacggcgtcgatctcagcttcacgccggtgctggacctcgactacggcgtcagc
cgcgccatcggtaaccgcgccttccatcgcgatccgcaggtcgtcgcccaactcgcccag
gccctgcttgccggcatggccgaagcgggcatgggctgcgtgggcaagcattttcccggc
cacggctacgtcgaggccgattcgcatcacgaggtgccggttgatgaccgggatttcgac
accatctggaacgaggacatcgccccgtaccgccaccgcctcggccgccagctggcgggc
gtgatgccggcgcacgtgatctatcccgctgccgatcccaacccggccggtttttccgcc
ttctggctgaaggacgtgctgcgccagcgcgtcggcttcaagggcgtgatcttcagcgac
gacctcaacatggaaggcgcggcgctggccggcgacatccttggccgctgcaaggcggct
tatgaagcgggctgcgacatgttgctggtgtgcaaccggcccgatcgggtcgccgagttg
ctcgaccgctgggcaccggtgccggatgcggagaagcttgcccgcgtggcggcgatcgct
ccggtgcggccgaaggcgccgtggctggccgatccgtttgcgctcgaactgcacgaaccc
tatctgacagcgcgcgggcaggttgcagccattgccgaggacgcgagcgggccgacgatg
acggcaggcacgatagggaaccaggcggtcgagatcctgaagaaggacgtttag

DBGET integrated database retrieval system