KEGG   Azoarcus sp. BH72: azo1973Help
Entry
azo1973           CDS       T00441                                 

Gene name
mhpF
Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K18366  acetaldehyde/propanal dehydrogenase [EC:1.2.1.10 1.2.1.87]
Organism
azo  Azoarcus sp. BH72
Pathway
azo00362  Benzoate degradation
azo00620  Pyruvate metabolism
azo00621  Dioxin degradation
azo00622  Xylene degradation
azo00650  Butanoate metabolism
azo01100  Metabolic pathways
azo01120  Microbial metabolism in diverse environments
azo01220  Degradation of aromatic compounds
Module
azo_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:azo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    azo1973 (mhpF)
   00650 Butanoate metabolism
    azo1973 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    azo1973 (mhpF)
   00622 Xylene degradation
    azo1973 (mhpF)
   00621 Dioxin degradation
    azo1973 (mhpF)
Enzymes [BR:azo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     azo1973 (mhpF)
    1.2.1.87  propanal dehydrogenase (CoA-propanoylating)
     azo1973 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA DUF2642
Motif
Other DBs
NCBI-ProteinID: CAL94590
RhizoBase: azo1973
UniProt: A1K6Y5
Position
complement(2169628..2170548)
Genome map
AA seq 306 aa AA seqDB search
MNKIKCALIGPGNIGTDLLYKLKRSPVLEPVWMVGIDAASEGLARARELGLKTTADGVDG
LLPHVKADGVQIAFDATSAYVHAENSRKLNELGVLMIDLTPAAIGPFCVPPVNLKDHVGR
GEMNVNMVTCGGQATIPMVAAVSRVQPVKYGEIVATVSSKSAGPGTRKNIDEFTRTTAGA
VEKVGGAKVGKAIIILNPAEPPLIMRDTVHCLTETEPDQQKITESIHAMIREVQKYVPGY
KLVNGPVFDGNRVSIYLEVEGLGDYLPKYAGNLDIMTAAGARTAEMFAEEILAGRLTLES
NRAVLA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagatcaaatgcgccttgattggtccgggcaacatcggcaccgatctgctctac
aaactcaagcgcagcccggtgctggagccggtgtggatggtgggcatcgacgccgcctcc
gaaggcctggcgcgcgcccgcgaactcggcctgaaaaccaccgccgacggcgtcgatggc
ctgctgccgcatgtgaaggccgatggcgtgcagatcgccttcgacgccacgtccgcctat
gtccatgccgagaacagccgcaagttgaatgaactcggcgtgctgatgatcgacttgacg
cccgcggccatcggccccttctgcgtgccgcccgtcaatctcaaggaccacgtcggccgc
ggcgaaatgaacgtgaacatggtcacctgcggcggccaggccacgatcccgatggtcgcg
gcggtgagccgcgtgcagccggtgaagtacggcgagatcgtcgccaccgtgtcgagcaag
tcggccggccccggcacccgcaagaacatcgacgaattcacccgcaccaccgccggcgcg
gtcgagaaggtgggcggcgccaaggtcggcaaggccatcatcatcctcaaccccgccgag
ccgccgctgatcatgcgcgacaccgtgcattgcctcaccgaaaccgagcccgaccagcag
aagatcaccgagtccatccacgcgatgatccgcgaggtccagaagtacgtgccgggctac
aagctggtcaatggcccggtcttcgatggcaaccgcgtctcgatctacctcgaagtcgaa
ggcctcggcgactacctgccgaagtacgccggcaacctcgacatcatgaccgcggccggt
gcccgcaccgccgagatgttcgccgaggaaatcctcgccggccgcctcaccctcgaatcc
aaccgcgccgtgctggcttga

DBGET integrated database retrieval system