KEGG   Azoarcus sp. BH72: azo2000Help
Entry
azo2000           CDS       T00441                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
azo  Azoarcus sp. BH72
Pathway
azo00040  Pentose and glucuronate interconversions
azo00052  Galactose metabolism
azo00500  Starch and sucrose metabolism
azo00520  Amino sugar and nucleotide sugar metabolism
azo01100  Metabolic pathways
azo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:azo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    azo2000 (galU)
   00052 Galactose metabolism
    azo2000 (galU)
   00500 Starch and sucrose metabolism
    azo2000 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    azo2000 (galU)
Enzymes [BR:azo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     azo2000 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: CAL94617
RhizoBase: azo2000
UniProt: A1K712
Position
complement(2202353..2203258)
Genome map
AA seq 301 aa AA seqDB search
MKKVTKAVFPVAGMGTRFLPATKASPKEMLPVVDKPLIQYAVEEAVAAGITDMIFITGRT
KRAIEDHFDKAYELETELEARGKKELLEVVAKTVPKGMNCVYIRQSEALGLGHAVLCASA
VVGDDEPFAVILADDLLDNHGGKPVMAQMSEVYNYHRCSVLGTMNVPRQETRQYGIVSTE
SQSGNIQRVTGIVEKPKPEEAPTTQAVVGRYILTPRIFEHLRALKPGAGGELQLTDAIAS
LLKEEAVLSYQYEGVRYDCGSKLGYLKAAVEFGLRHHEVGAEFAAYLNDRFPGELAKKKE
K
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaggtcaccaaggcggtctttccggttgcgggcatgggcacgcgcttcctgccg
gccaccaaggccagtccgaaggaaatgctgccggtcgtcgacaagccgctgatccagtac
gcggtcgaagaagccgtcgctgccggcatcaccgacatgatcttcatcaccggccgcacc
aagcgtgcgatcgaggaccacttcgacaaggcctacgaactcgagaccgaactcgaagcc
cgcggcaagaaggaactgctggaagtggtcgccaagaccgtgcccaagggcatgaactgc
gtctacatccgccagtccgaagcgctcggcctcggccacgcggtgctgtgcgcctccgcg
gtggtgggcgacgacgagcccttcgcggtcattctcgccgacgacctgctcgacaaccac
ggcggcaagccggtgatggcgcagatgagcgaggtctataactatcaccgctgctcggtg
ctcggcaccatgaacgtgccgcgccaggaaacccgccagtacggcatcgtcagcaccgaa
agccagagcggcaacatccagcgcgtgaccggcatcgtcgaaaagccgaagcccgaggaa
gcgccgacgacccaggccgtcgtcggccgctacatcctgaccccgcgcattttcgagcat
ctgcgcgcgctcaagccgggcgccggtggcgaactgcagctgaccgatgcgatcgcctcg
ctgctgaaggaagaagcggtgctctcctaccagtacgagggcgtgcgctatgactgcggc
tccaagctcggctacctgaaggctgcggtggaattcggcctgcgccaccatgaagtgggg
gctgaattcgcggcctacctcaacgaccgcttcccgggcgagttggcgaagaagaaggaa
aagtaa

DBGET integrated database retrieval system