KEGG   Azoarcus sp. BH72: azo2357Help
Entry
azo2357           CDS       T00441                                 

Definition
(GenBank) probable amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
azo  Azoarcus sp. BH72
Pathway
azo00330  Arginine and proline metabolism
azo00360  Phenylalanine metabolism
azo00380  Tryptophan metabolism
azo00627  Aminobenzoate degradation
azo00643  Styrene degradation
azo01100  Metabolic pathways
azo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:azo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    azo2357
   00360 Phenylalanine metabolism
    azo2357
   00380 Tryptophan metabolism
    azo2357
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    azo2357
   00643 Styrene degradation
    azo2357
Enzymes [BR:azo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     azo2357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: CAL94974
RhizoBase: azo2357
UniProt: A1K819
Position
complement(2596593..2598086)
Genome map
AA seq 497 aa AA seqDB search
MSAPDFQHLTAAQAVRDLRAGRYSAEQLVLACQARIDRFNPTLNALVTLNREGALAAARG
ADRRLAQGGLAPALLGVPVSIKDAFATRDMLTTASHRPLAAYRPGADATVVARWREAGAV
LMGKSNLPELAGAPHCWSPLFGLTRNPWNPALTPGGSSGGAAVAVAAGFSLLDIGSDIAG
SIRIPAAYCGIAGLKATENRIPRTGHIPHLPPEFGGPGRSVWHMLAFGVLARSVEDLQLG
YGLLAGPDGVDCTVPPFLPEPPSLPTTARAVAPMRIALWDDFAGMPLCPRIRRGLQNMAG
KLRASGHEVVRCAPADFDVGAAWHAFGLIGGAEIGLGMPGWQRRLFLALRPLLPRDHVIT
RAVAAGMRFDLRRYNQALNQREGLIRSLERFVGEWDAVICPVAPTGPYPGEPMPPTRKPP
RLNVGEATLPYLEATIAMTAPFSLTGSPVLSLPVGIEDGLPVGVQVIGKRWQEHALLETG
RRLENALGGFVPPPLAA
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgccggacttccagcatctcaccgccgcgcaggcggtccgcgatctgcgcgcg
gggcgctattcggccgagcaactggtgctcgcctgtcaggcgcgcatcgaccgcttcaac
ccgacgctgaacgcgctggtgacgctcaaccgcgagggcgcgctggccgccgcgcgcggg
gcggaccggcgtctcgcccagggtggcctggcgccggcgctgctcggcgtgccggtttcc
atcaaggacgcctttgccacccgggacatgctcaccaccgccagccatcggccgctggcc
gcgtaccggccgggggccgatgccacggtggttgcgcgctggcgcgaggccggcgcggtg
ttgatgggcaagagcaatctaccggagctggcgggcgcgccgcactgctggagcccgctg
ttcggcctcacgcgcaatccgtggaacccggcgctcacgccgggcggcagttccggcggc
gccgcggtggccgtggccgcgggattctcgctgctcgacatcggcagcgacatcgccggc
tcgatccgcatccccgccgcctactgcggcatcgcggggctgaaggccaccgagaaccgc
atcccgcgcaccggccacatcccgcacctgccgccggaattcggcggaccgggccgcagc
gtctggcacatgctggcgtttggggtgctggcgcgcagcgtggaggacctgcaactgggc
tacggcctgctcgccgggccggacggggtggattgcaccgtgccgccctttctgccggaa
ccgccatcgctgccgacgacggccagggcggtcgcgccgatgcgcatcgcgttgtgggac
gacttcgccggcatgccgctgtgtccgcgcatccggcgcggtctgcagaacatggcgggc
aagctgcgggctagcgggcacgaagtcgtccgctgcgcaccggcggatttcgacgtgggc
gccgcgtggcacgccttcggcctgatcggcggggcggaaatcggactcggcatgccgggc
tggcagcgccggctcttcctggcgctgcgaccgctgctgccgcgcgaccacgtcatcacc
cgggcggtggccgccggcatgcgcttcgatctgcgccgctacaaccaggcgctgaaccag
cgcgaaggtctgatccggtcgctggaacgctttgtgggcgagtgggatgcggtcatctgc
ccggtggcgccgacgggcccttatcccggcgagccgatgccgcccacccgaaagccgccg
cggctgaacgtgggcgaggccacactgccgtatctggaagccaccattgccatgaccgcg
ccgttctcgctgaccggcagcccggtgttgagcctgccggtgggcatcgaggacggtttg
ccggtcggggtgcaggtgatcggcaagcgctggcaggaacacgcactgctggaaaccggc
cgccggctggaaaacgccctcgggggattcgtgccgcccccgctcgcggcttga

DBGET integrated database retrieval system