KEGG   Azoarcus sp. BH72: azo2698Help
Entry
azo2698           CDS       T00441                                 

Gene name
pepM
Definition
(GenBank) putative phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
azo  Azoarcus sp. BH72
Pathway
azo00440  Phosphonate and phosphinate metabolism
azo01100  Metabolic pathways
azo01120  Microbial metabolism in diverse environments
azo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:azo00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    azo2698 (pepM)
Enzymes [BR:azo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     azo2698 (pepM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase CTP_transf_like ComA
Motif
Other DBs
NCBI-ProteinID: CAL95314
RhizoBase: azo2698
UniProt: A1K909
Position
2975648..2976952
Genome map
AA seq 434 aa AA seqDB search
MKTKIVYVGMSADLVHSGHLNIIRHAASLGEVVIGLLTDKAIASYKRIPYMPFEQRMAVV
ENIKGVSRVVPQTTLDYTPNLELLKPDYVVHGDDWREGVQRETRQKVIDTLKQWGGELVE
IPYTAGISSTRLQAAIKEIGTTPDIRRSALRRLLQVKPLIRFLDIHNALSGLIIEHTAVD
TPSGRREFDGMWGSSLTDSTAKGKPDIEAVDVSARVQTLNEVLEVTTKPIIYDGDTGGQP
EHFNFTVRTLERLGISAIVIEDKTGLKRNSLFGNDVPQTQESIENFCNKIRTGKRAQATD
EFMIIARIESLILDKGVDDAIERAQAYLAAGADGIMIHSRKTTPDEIFAFCERYRQLENR
KYLVAVPSTYNTVTEEELQQRGVNIVIYANHLLRSAYPAMVETARCILEHHRSSECDARL
LPINDILALIPGTR
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgaagatcgtgtatgtcggcatgagcgccgacctcgtccactcaggccacctg
aacatcatccgccacgctgcaagcctgggcgaagtcgtgatcggactgctgaccgacaag
gccattgcgagttacaagcgcattccgtacatgcccttcgagcaaaggatggcggtggtc
gagaatatcaagggcgtctcgcgcgtcgtgccccagaccacgctcgactacacgccgaat
ctcgaattgctcaaacccgactacgtggtgcacggcgatgactggcgcgagggcgtccag
cgcgaaacgcggcagaaagtcatcgacacgctcaagcaatggggcggcgaactggtggag
attccttacaccgccggcatttcatccacccgtctgcaggccgcgatcaaggaaatcggc
accacgcccgacatccggcgcagcgccctgcgccgcctgctgcaggtcaagccgctgatc
cgctttctcgatatccataacgccctctcggggctgatcatcgagcacaccgcggtggat
acgcccagcggacgacgcgagttcgacggcatgtggggcagcagcctgaccgactcgacc
gcaaagggaaaacccgacatcgaggcggtcgacgtttccgcccgggtgcagacgctcaac
gaagtcctggaagtcaccaccaagcccatcatctacgacggcgataccggcggtcagccc
gaacatttcaacttcacggtccgcacgctggagcgcctgggcatctcggcgatcgtcatc
gaggacaagaccgggctgaagcgcaattcgctgttcggcaacgacgtgccgcaaacgcag
gagagcatcgagaacttctgcaacaagatccgcaccggcaagcgcgcgcaggcgaccgac
gagttcatgatcatcgcccgcatcgaaagcctcatcctggacaagggcgtcgatgatgcg
atcgaacgtgcgcaagcctatctggccgcgggcgcggacggcatcatgatccacagccgc
aagaccacgcccgacgaaatcttcgcgttctgcgagcgctaccgccagctcgaaaaccgc
aagtacctggtggcggtgccgtccacctacaacaccgtcaccgaagaagaactgcagcaa
cgcggcgtgaacatcgtcatctacgccaaccacctgttgcgcagcgcgtacccggccatg
gtcgagaccgccaggtgcatcctggagcatcaccgctcctccgagtgcgacgcccggctg
cttccgatcaacgatatattggcactcattccaggcacccgatga

DBGET integrated database retrieval system