KEGG   Azoarcus sp. BH72: azo3307Help
Entry
azo3307           CDS       T00441                                 

Gene name
cat1
Definition
(GenBank) probable coenzyme A transferase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
azo  Azoarcus sp. BH72
Pathway
azo00020  Citrate cycle (TCA cycle)
azo00620  Pyruvate metabolism
azo00650  Butanoate metabolism
azo01100  Metabolic pathways
azo01110  Biosynthesis of secondary metabolites
azo01120  Microbial metabolism in diverse environments
azo01130  Biosynthesis of antibiotics
azo01200  Carbon metabolism
Module
azo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
azo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:azo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    azo3307 (cat1)
   00620 Pyruvate metabolism
    azo3307 (cat1)
   00650 Butanoate metabolism
    azo3307 (cat1)
Enzymes [BR:azo01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     azo3307 (cat1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CitF CoA_trans
Motif
Other DBs
NCBI-ProteinID: CAL95923
RhizoBase: azo3307
UniProt: A1KAR7
Position
complement(3643550..3645082)
Genome map
AA seq 510 aa AA seqDB search
MSNSLSNPNADRVLSPRLRNKIMSAEAAAALIPSGVNVGMSGFTGAGYPKAVPAALAKRI
MDANLNGKNFKIGVWTGASTAPELDGALAMVDGVELRLPYQSDPTCRKRINAGEMEYLDM
HLSQVAQFVWFGFLGKLDVAVVEVAGILEDGRLVPSSSVGNNKTWLDQADKVILEVNSWQ
NPALEGMHDIYYGTALPPYRKPIPLLKTDDRIGEPYLRCDPDKIIAVVETHTPDRNSAFS
APDENSRRIAGHILEFLEHEVKKGRLPPNLLPLQSGVGNIANAVMAGLNEGPFDNLTAYT
EVLQDGMLDLIKSGKLSCASATAFSLSPAALSELNADLARYRERIILRPQEISNHPELIR
RLGVIAMNGMIEADIYGNVNSTHVMGTRIMNGIGGSGDFARNAYISIFMTPSQAKGGDIS
CIVPMASHVDHTEHDVQVLVTEQGLADLRGLSPKQRARVIIDNCAHPHFRPALMDYYKRS
LMHSEGKQTPHLLDEALSWHLKYLRGGQML
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgtccaactcgctttccaacccgaacgccgaccgcgtcctctcgccgcgtctgcgcaac
aagatcatgtccgccgaggccgccgccgccctcatcccgtccggggtgaatgtcggcatg
agcggcttcaccggcgccggctaccccaaggcggtgccggccgcgctcgccaagcgcatc
atggatgccaacctcaacggcaagaacttcaagatcggcgtatggaccggcgcctccacc
gcgcccgaactcgacggcgcgctcgcgatggtcgacggcgtggagctgcgcctgccctac
cagtccgaccccacctgccgcaagcgcatcaatgccggcgagatggaatacctcgacatg
cacctgtcgcaggtcgcgcagttcgtctggttcggcttcctcggcaagctcgacgtggcg
gtggtggaagtggcgggcatcctggaggacggccgcctggtgccgtcgtcctcggtgggt
aacaacaagacctggctggatcaggccgacaaggtcatcctggaagtgaacagctggcag
aacccggcgctggaagggatgcacgacatctactacggcaccgcgctgccgccgtaccgc
aagccgatcccgctgctgaagaccgacgaccgcatcggcgaaccttatctgcgttgcgac
ccggacaagatcatcgcggtggtcgaaacccataccccggaccgcaactcggcgttttcc
gcgccggacgagaactcccgccgcatcgccggtcacatcctcgaattcctcgagcacgag
gtgaagaagggccgcctgccgcccaacctgctgccgctgcagtcgggcgtgggcaacatt
gccaacgcggtgatggcggggctcaacgagggcccgttcgacaacctcaccgcctacacc
gaggtgctgcaggacggcatgctcgacctgatcaagtcgggcaagctcagctgcgcttcc
gccaccgcgttttcgctgtcgccggccgcgctgtccgaactcaatgccgacctcgcgcgc
taccgcgagcgcatcatcctgcgcccgcaggagatctcgaatcatccggagctgatccgc
cgcctcggcgtgatcgcgatgaacggcatgatcgaggccgacatctacggcaacgtgaac
tccacccatgtgatgggcacgcggatcatgaacggcatcggcggctcgggcgatttcgcg
cgcaacgcctacatctcgatcttcatgacgccgtcgcaggccaagggcggcgacatctcc
tgcatcgtgccgatggcgtcgcacgtggaccacaccgagcacgacgtgcaggtactggtg
accgagcagggcctggccgacctgcgcgggctgtcgcccaagcagcgcgcgcgcgtgatc
atcgacaactgtgcgcacccgcacttccgcccggcgctgatggattactacaagcgctcg
ctgatgcactccgaaggcaagcagacgccgcacctgctggacgaggcgctgtcctggcac
ctgaagtacctgcgcggcggccagatgttgtaa

DBGET integrated database retrieval system