KEGG   Azoarcus olearius BH72: azo3876
Entry
azo3876           CDS       T00441                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
azo  Azoarcus olearius BH72
Pathway
azo03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:azo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    azo3876
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:azo02044]
    azo3876
Secretion system [BR:azo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   azo3876
SSDB
Motif
Pfam: Phage_GPD Gp5_C Phage_base_V DUF2345
Other DBs
NCBI-ProteinID: CAL96492
RhizoBase: azo3876
UniProt: A1KCD6
Position
4249321..4251393
AA seq 690 aa
MADQSQFELITPLGSGVLVFQALAADEALSQVSEFEIDCLSDKTDINLDDILGKQLSLRV
MLPTGGKRYFSGYVTRFAHTGTQGRYQTYRASVRPWLWFLGRTADCRIFQSRTVPDIVKQ
VFSEHGVADFRNALSGSYRTREYCVQYRETDLAFVSRLLEEEGIYYFFEHDENKNTLVLA
DAYAAHSSTAGYEEIEFVENRQGGGDELGFVSQWQFERQVMPGKVMLRDYDFTKPSVGLE
ASAVVPREHDEGKHEVFDYPGEFDQVADGRHYAKVRVDELHAQFELSRARSSARGLAVGH
LFKLAGHARRDQNREYLITAAQTRVRAEGRESEAGAGSQFECHFSALNSRQDYRPPRLTP
RPQVKGPQTAVVVGPSGNEIYTDEYGRVKVQFHWDRYGTKDEHSSCWIRVSHPWAGKNWG
FIAIPRIGQEVIVEFLEGDPDQPIITGRVYNAEQMPPYALPDNMTQTGIKTRSTLGGGTD
NFNEIRFEDKKGEEQLFIHAEKNQDIEVENDETHWVGHDRTKNIDHNETVTVGNDRTESV
GNNETISIGNNRTESVGANETISVGGNRAEDVGQNETVSIGKDRSESIGNNDAHDVAKNQ
TIAIGENQTLEVGKARSTTVGDDDKLQVGKKLVIEAGDEITIKTGSASITMKKDGTIQIK
GKDITIKGDGQIGIKAASDVVIKGAKISEN
NT seq 2073 nt   +upstreamnt  +downstreamnt
gtggcagatcaatcgcaattcgaactcatcaccccgctgggcagcggcgtgctcgtattc
caggcgctcgccgccgacgaggcgctgtcgcaggtcagcgaattcgagatcgactgcctc
tccgacaagaccgacatcaacctcgacgacatcctcggcaagcagctcagcctgcgggtg
atgctgcccaccggcggcaagcgctacttcagcggctacgtcacccgcttcgcccacacc
ggcacccagggccgctaccagacctaccgcgcgagcgtgcggccgtggctgtggttcctc
ggccgcaccgccgactgccgcatcttccagtcgcgcacggtgcccgacatcgtcaagcag
gtcttctccgaacacggcgtcgccgacttccgcaacgcgctcagcggcagctaccgcacg
cgcgaatactgcgtgcagtaccgcgagaccgacctcgccttcgtcagccggctgctggaa
gaagagggcatctattacttcttcgagcacgacgagaacaagaacacgctggtgctggcc
gacgcctacgccgcgcacagcagcaccgccggctacgaggagatcgagttcgtcgagaac
cgccagggcggcggcgacgagctgggcttcgtcagccagtggcagttcgagcgccaggtg
atgccgggcaaggtcatgctgcgcgactacgacttcaccaagccctcggtcgggctggaa
gcctcggcggtggtgccgcgcgaacacgacgagggcaagcacgaggtgttcgactacccc
ggcgagttcgaccaggtggccgacggccgccactacgccaaggtgcgcgtcgatgagctg
cacgcgcagttcgaactgtcccgcgcgcgcagcagcgcccgcggcctggcggtgggccac
ctgttcaagctcgccggtcacgcccgccgcgaccagaaccgcgagtacctgatcaccgcg
gcgcagacccgcgtgcgtgccgaagggcgggaatccgaagcgggtgcgggcagccagttc
gagtgccacttcagcgccctcaacagccgccaggattaccgcccgccgcggctgaccccg
cgcccgcaggtgaaggggccgcagaccgcggtagtggtcggcccgtccggcaacgagatc
tacaccgacgaatacggccgcgtgaaggtgcagttccactgggaccgctacggcaccaag
gacgagcacagctcgtgctggatccgcgtctcccatccctgggcgggcaagaactggggc
ttcatcgccatcccccgcatcggccaggaggtgatcgtcgaattcctcgagggcgatccc
gaccagccgatcatcaccggccgggtctacaacgccgagcagatgccgccatacgcgctg
cccgacaacatgacccagaccggcatcaagacgcgctccacgctcggcggcggcaccgac
aacttcaacgagatccgcttcgaggacaagaagggcgaggagcagctcttcatccacgcc
gagaagaaccaggacatcgaggtcgagaacgacgagacccactgggtcggccacgaccgc
accaagaacatcgaccacaacgagacggtcaccgtgggcaacgaccgcaccgagtcggtc
ggcaacaacgaaaccatcagcatcggcaacaaccgcaccgaatcggtgggcgccaacgaa
accatctcggtgggcggcaaccgcgccgaggacgtcggccagaacgaaaccgtcagcatc
ggcaaggaccgcagcgagagcatcggcaacaacgacgcccacgacgtcgccaagaaccag
accatcgcgatcggcgaaaaccagacgctggaggtgggcaaggcgcgctccaccacggtc
ggcgatgacgacaagctgcaggtcggcaagaaactggtgatcgaggccggcgacgagatc
accatcaagaccggcagcgccagcatcaccatgaagaaggacggcacgatccagatcaag
ggcaaggacatcaccatcaagggcgacggccagatcggcatcaaggccgcttccgacgtg
gtgatcaagggcgccaagatctccgagaactga

DBGET integrated database retrieval system